Detailed information
Bioinformatically predicted
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | RB214_RS14850 | Genome accession | NZ_CP133569 |
| Coordinates | 3206108..3206536 (+) | Length | 142 a.a. |
| NCBI ID | WP_309167692.1 | Uniprot ID | - |
| Organism | Pseudoalteromonas sp. HL-AS1 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3192192..3258234 | 3206108..3206536 | within | 0 |
Gene organization within MGE regions
Location: 3192192..3258234
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RB214_RS14795 (RB214_14795) | - | 3192192..3193160 (-) | 969 | WP_309167684.1 | IS30 family transposase | - |
| RB214_RS14800 (RB214_14800) | - | 3193327..3193842 (+) | 516 | WP_309167685.1 | hypothetical protein | - |
| RB214_RS14805 (RB214_14805) | - | 3193853..3194533 (-) | 681 | WP_309167686.1 | tRNA-uridine aminocarboxypropyltransferase | - |
| RB214_RS14810 (RB214_14810) | lpdA | 3194670..3196094 (-) | 1425 | WP_002957761.1 | dihydrolipoyl dehydrogenase | - |
| RB214_RS14815 (RB214_14815) | aceF | 3196300..3198216 (-) | 1917 | WP_309167687.1 | pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase | - |
| RB214_RS14820 (RB214_14820) | aceE | 3198227..3200893 (-) | 2667 | WP_002957763.1 | pyruvate dehydrogenase (acetyl-transferring), homodimeric type | - |
| RB214_RS14825 (RB214_14825) | pdhR | 3200984..3201733 (-) | 750 | WP_002957764.1 | pyruvate dehydrogenase complex transcriptional repressor PdhR | - |
| RB214_RS14830 (RB214_14830) | - | 3202371..3202823 (+) | 453 | WP_309167688.1 | transposase | - |
| RB214_RS14835 (RB214_14835) | ampE | 3202975..3203826 (-) | 852 | WP_309167689.1 | beta-lactamase regulator AmpE | - |
| RB214_RS14840 (RB214_14840) | ampD | 3203840..3204394 (-) | 555 | WP_309167690.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
| RB214_RS14845 (RB214_14845) | nadC | 3204722..3205567 (+) | 846 | WP_309167691.1 | carboxylating nicotinate-nucleotide diphosphorylase | - |
| RB214_RS14850 (RB214_14850) | pilA/pilAI | 3206108..3206536 (+) | 429 | WP_309167692.1 | pilin | Machinery gene |
| RB214_RS14855 (RB214_14855) | - | 3206588..3208261 (+) | 1674 | WP_309167693.1 | Wzy polymerase domain-containing protein | - |
| RB214_RS14860 (RB214_14860) | pilC | 3208271..3209500 (+) | 1230 | WP_309167694.1 | type II secretion system F family protein | Machinery gene |
| RB214_RS14865 (RB214_14865) | pilD | 3209672..3210565 (+) | 894 | WP_309169028.1 | A24 family peptidase | Machinery gene |
| RB214_RS14870 (RB214_14870) | coaE | 3210567..3211220 (+) | 654 | WP_309167695.1 | dephospho-CoA kinase | - |
| RB214_RS14875 (RB214_14875) | pilB | 3211314..3212990 (+) | 1677 | WP_309167696.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| RB214_RS14880 (RB214_14880) | yacG | 3213102..3213332 (+) | 231 | WP_024597564.1 | DNA gyrase inhibitor YacG | - |
| RB214_RS14885 (RB214_14885) | - | 3213405..3213893 (-) | 489 | WP_309167697.1 | periplasmic heavy metal sensor | - |
| RB214_RS14890 (RB214_14890) | - | 3214322..3215011 (+) | 690 | WP_197098823.1 | response regulator | - |
| RB214_RS14895 (RB214_14895) | - | 3214989..3216404 (+) | 1416 | WP_309167698.1 | ATP-binding protein | - |
| RB214_RS14900 (RB214_14900) | - | 3216408..3217355 (+) | 948 | WP_309167699.1 | alpha/beta fold hydrolase | - |
| RB214_RS14905 (RB214_14905) | - | 3217315..3218181 (-) | 867 | WP_081709160.1 | cation diffusion facilitator family transporter | - |
| RB214_RS14910 (RB214_14910) | trmL | 3218343..3218807 (+) | 465 | WP_309167700.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| RB214_RS14915 (RB214_14915) | gpsA | 3218876..3219883 (-) | 1008 | WP_309167701.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| RB214_RS14920 (RB214_14920) | secB | 3219887..3220372 (-) | 486 | WP_309167702.1 | protein-export chaperone SecB | - |
| RB214_RS14925 (RB214_14925) | grxC | 3220407..3220664 (-) | 258 | WP_002957783.1 | glutaredoxin 3 | - |
| RB214_RS14930 (RB214_14930) | - | 3220696..3221127 (-) | 432 | WP_007376037.1 | rhodanese-like domain-containing protein | - |
| RB214_RS14935 (RB214_14935) | gpmM | 3221465..3223009 (+) | 1545 | WP_007582830.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| RB214_RS14940 (RB214_14940) | - | 3223013..3224152 (+) | 1140 | WP_197098828.1 | murein hydrolase activator EnvC | - |
| RB214_RS14945 (RB214_14945) | - | 3224187..3225452 (+) | 1266 | WP_309167703.1 | S41 family peptidase | - |
| RB214_RS14950 (RB214_14950) | - | 3225503..3226264 (+) | 762 | WP_309167704.1 | divergent polysaccharide deacetylase family protein | - |
| RB214_RS14955 (RB214_14955) | rpoH | 3226607..3227470 (-) | 864 | WP_002957791.1 | RNA polymerase sigma factor RpoH | - |
| RB214_RS14960 (RB214_14960) | ftsX | 3227785..3228771 (-) | 987 | WP_165744576.1 | permease-like cell division protein FtsX | - |
| RB214_RS14965 (RB214_14965) | ftsE | 3228768..3229445 (-) | 678 | WP_002957793.1 | cell division ATP-binding protein FtsE | - |
| RB214_RS14970 (RB214_14970) | ftsY | 3229533..3231464 (-) | 1932 | WP_309167705.1 | signal recognition particle-docking protein FtsY | - |
| RB214_RS14975 (RB214_14975) | rsmD | 3231672..3232277 (+) | 606 | WP_165744710.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| RB214_RS14980 (RB214_14980) | rpsU | 3232423..3232638 (+) | 216 | WP_002957797.1 | 30S ribosomal protein S21 | - |
| RB214_RS14985 (RB214_14985) | - | 3232658..3233104 (+) | 447 | WP_007376027.1 | GatB/YqeY domain-containing protein | - |
| RB214_RS14990 (RB214_14990) | dnaG | 3233349..3235100 (+) | 1752 | WP_165744708.1 | DNA primase | - |
| RB214_RS14995 (RB214_14995) | rpoD | 3235491..3237341 (+) | 1851 | WP_309167706.1 | RNA polymerase sigma factor RpoD | - |
| RB214_RS15000 (RB214_15000) | prmA | 3237409..3238290 (+) | 882 | WP_002957801.1 | 50S ribosomal protein L11 methyltransferase | - |
| RB214_RS15005 (RB214_15005) | dusB | 3238573..3239544 (+) | 972 | WP_024603689.1 | tRNA dihydrouridine synthase DusB | - |
| RB214_RS15010 (RB214_15010) | fis | 3239564..3239854 (+) | 291 | WP_002957804.1 | DNA-binding transcriptional regulator Fis | - |
| RB214_RS15015 (RB214_15015) | purH | 3240180..3241766 (+) | 1587 | WP_309167707.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| RB214_RS15020 (RB214_15020) | - | 3241873..3242694 (+) | 822 | WP_309167708.1 | methyltransferase | - |
| RB214_RS15025 (RB214_15025) | purD | 3242710..3243993 (+) | 1284 | WP_165744701.1 | phosphoribosylamine--glycine ligase | - |
| RB214_RS15030 (RB214_15030) | - | 3244106..3246646 (+) | 2541 | WP_309167709.1 | EAL domain-containing protein | - |
| RB214_RS15035 (RB214_15035) | - | 3246669..3247478 (+) | 810 | WP_024597548.1 | DUF2797 domain-containing protein | - |
| RB214_RS15040 (RB214_15040) | - | 3247485..3247778 (+) | 294 | WP_002957811.1 | hypothetical protein | - |
| RB214_RS15045 (RB214_15045) | - | 3247792..3248709 (-) | 918 | WP_309167710.1 | histone deacetylase family protein | - |
| RB214_RS15050 (RB214_15050) | - | 3248810..3250351 (-) | 1542 | WP_309167711.1 | serine hydrolase | - |
| RB214_RS15055 (RB214_15055) | - | 3250367..3250861 (-) | 495 | WP_182747947.1 | gamma-glutamylcyclotransferase family protein | - |
| RB214_RS15060 (RB214_15060) | - | 3250888..3251526 (-) | 639 | WP_197111575.1 | LysE family translocator | - |
| RB214_RS15065 (RB214_15065) | - | 3251538..3252311 (-) | 774 | WP_002957816.1 | hypothetical protein | - |
| RB214_RS15070 (RB214_15070) | - | 3252359..3252844 (-) | 486 | WP_002957817.1 | CreA family protein | - |
| RB214_RS15075 (RB214_15075) | - | 3253052..3253381 (+) | 330 | WP_002957818.1 | 5-carboxymethyl-2-hydroxymuconate Delta-isomerase | - |
| RB214_RS15080 (RB214_15080) | - | 3253983..3254282 (-) | 300 | WP_309167712.1 | HigA family addiction module antitoxin | - |
| RB214_RS15085 (RB214_15085) | - | 3254354..3254659 (-) | 306 | WP_309167713.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| RB214_RS15090 (RB214_15090) | - | 3255257..3255436 (+) | 180 | WP_309167714.1 | hypothetical protein | - |
| RB214_RS15095 (RB214_15095) | - | 3255429..3256310 (+) | 882 | WP_309167715.1 | site-specific integrase | - |
| RB214_RS15100 (RB214_15100) | - | 3256352..3256714 (-) | 363 | WP_309167716.1 | hypothetical protein | - |
| RB214_RS15105 (RB214_15105) | - | 3256766..3257038 (-) | 273 | WP_309167717.1 | hypothetical protein | - |
| RB214_RS15110 (RB214_15110) | - | 3257181..3257768 (-) | 588 | WP_309167718.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 14470.40 Da Isoelectric Point: 5.0909
>NTDB_id=874970 RB214_RS14850 WP_309167692.1 3206108..3206536(+) (pilA/pilAI) [Pseudoalteromonas sp. HL-AS1]
MKTMTQQNQKGFTLIELMIVVAIIGILAAVALPAYQNYTSKSQVTACLAEIAPGKTAFEIKMNEGSISGTLDADDLGINN
KACSGVAITADSADGEGTGSIKGTVSGGPAVNGKTVTLSRSKAGEWTCASTADAEHKPTNCS
MKTMTQQNQKGFTLIELMIVVAIIGILAAVALPAYQNYTSKSQVTACLAEIAPGKTAFEIKMNEGSISGTLDADDLGINN
KACSGVAITADSADGEGTGSIKGTVSGGPAVNGKTVTLSRSKAGEWTCASTADAEHKPTNCS
Nucleotide
Download Length: 429 bp
>NTDB_id=874970 RB214_RS14850 WP_309167692.1 3206108..3206536(+) (pilA/pilAI) [Pseudoalteromonas sp. HL-AS1]
ATGAAAACAATGACACAACAGAACCAAAAGGGTTTCACCCTAATTGAATTAATGATCGTAGTAGCAATTATAGGTATTTT
GGCGGCAGTAGCACTACCTGCTTATCAAAACTACACATCTAAATCACAAGTTACAGCTTGTTTAGCTGAAATTGCTCCGG
GCAAAACTGCATTTGAAATCAAAATGAATGAAGGCAGCATTTCTGGCACTCTTGATGCTGATGACTTAGGTATAAATAAT
AAGGCTTGTTCAGGTGTGGCAATAACTGCTGACTCTGCTGATGGTGAAGGTACGGGTAGTATTAAAGGCACTGTTTCGGG
CGGTCCTGCAGTAAACGGTAAGACAGTAACATTATCTCGCTCTAAAGCTGGCGAGTGGACATGTGCGTCAACAGCTGATG
CAGAACACAAACCAACTAACTGCTCTTAA
ATGAAAACAATGACACAACAGAACCAAAAGGGTTTCACCCTAATTGAATTAATGATCGTAGTAGCAATTATAGGTATTTT
GGCGGCAGTAGCACTACCTGCTTATCAAAACTACACATCTAAATCACAAGTTACAGCTTGTTTAGCTGAAATTGCTCCGG
GCAAAACTGCATTTGAAATCAAAATGAATGAAGGCAGCATTTCTGGCACTCTTGATGCTGATGACTTAGGTATAAATAAT
AAGGCTTGTTCAGGTGTGGCAATAACTGCTGACTCTGCTGATGGTGAAGGTACGGGTAGTATTAAAGGCACTGTTTCGGG
CGGTCCTGCAGTAAACGGTAAGACAGTAACATTATCTCGCTCTAAAGCTGGCGAGTGGACATGTGCGTCAACAGCTGATG
CAGAACACAAACCAACTAACTGCTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
53.147 |
100 |
0.535 |
| pilA | Pseudomonas aeruginosa PAK |
45.205 |
100 |
0.465 |
| pilA | Acinetobacter baumannii strain A118 |
46.715 |
96.479 |
0.451 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
45.652 |
97.183 |
0.444 |
| pilA/pilA1 | Eikenella corrodens VA1 |
38.365 |
100 |
0.43 |
| pilA | Vibrio cholerae strain A1552 |
41.216 |
100 |
0.43 |
| pilA | Vibrio cholerae C6706 |
41.216 |
100 |
0.43 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
41.216 |
100 |
0.43 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
36.196 |
100 |
0.415 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
42.537 |
94.366 |
0.401 |
| pilA2 | Legionella pneumophila str. Paris |
41.176 |
95.775 |
0.394 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
39.706 |
95.775 |
0.38 |
| comP | Acinetobacter baylyi ADP1 |
36.986 |
100 |
0.38 |
| pilV | Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 |
38.235 |
95.775 |
0.366 |