Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | WHL52_RS13350 | Genome accession | NZ_CP149576 |
| Coordinates | 2547666..2547839 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain DSM 10 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2542666..2552839
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WHL52_RS13335 | gcvT | 2543465..2544553 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WHL52_RS13340 | yqhH | 2544995..2546668 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| WHL52_RS13345 | yqhG | 2546689..2547483 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| WHL52_RS13350 | sinI | 2547666..2547839 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| WHL52_RS13355 | sinR | 2547873..2548208 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| WHL52_RS13360 | tasA | 2548301..2549086 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| WHL52_RS13365 | sipW | 2549150..2549722 (-) | 573 | WP_003246088.1 | signal peptidase I | - |
| WHL52_RS13370 | tapA | 2549706..2550467 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| WHL52_RS13375 | yqzG | 2550739..2551065 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| WHL52_RS13380 | spoIIT | 2551107..2551286 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| WHL52_RS13385 | comGG | 2551357..2551731 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| WHL52_RS13390 | comGF | 2551732..2552115 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| WHL52_RS13395 | comGE | 2552141..2552488 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=874971 WHL52_RS13350 WP_003230187.1 2547666..2547839(+) (sinI) [Bacillus subtilis strain DSM 10]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=874971 WHL52_RS13350 WP_003230187.1 2547666..2547839(+) (sinI) [Bacillus subtilis strain DSM 10]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |