NTDB

Overview

Name	pilA/pilAI	Type	Machinery gene
Locus tag	RAB70_RS09030	Genome accession	NZ_CP132342
Coordinates	2134632..2135024 (+)	Length	130 a.a.
NCBI ID	WP_148828476.1	Uniprot ID	-
Organism	Xanthomonas sontii strain PPL1
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2129632..2140024

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RAB70_RS09010 (RAB70_09010)	-	2130052..2131386 (+)	1335	WP_148828478.1	HAMP domain-containing sensor histidine kinase	-
RAB70_RS09015 (RAB70_09015)	coaE	2131495..2132124 (-)	630	WP_148828477.1	dephospho-CoA kinase	-
RAB70_RS09020 (RAB70_09020)	-	2132138..2133001 (-)	864	WP_017910397.1	A24 family peptidase	-
RAB70_RS09025 (RAB70_09025)	pilC	2133008..2134267 (-)	1260	WP_148828512.1	type II secretion system F family protein	Machinery gene
RAB70_RS09030 (RAB70_09030)	pilA/pilAI	2134632..2135024 (+)	393	WP_148828476.1	pilin	Machinery gene
RAB70_RS09035 (RAB70_09035)	-	2135130..2135555 (+)	426	WP_148828475.1	pilin	-
RAB70_RS09040 (RAB70_09040)	-	2135584..2137422 (+)	1839	WP_148828474.1	hypothetical protein	-
RAB70_RS09045 (RAB70_09045)	-	2137507..2138640 (-)	1134	WP_148828473.1	glycosyltransferase	-
RAB70_RS09050 (RAB70_09050)	-	2138682..2139632 (-)	951	WP_148828472.1	YbhN family protein	-

Sequence

Protein

Download Length: 130 a.a. Molecular weight: 13534.74 Da Isoelectric Point: 9.5775

                                >NTDB_id=868274 RAB70_RS09030 WP_148828476.1 2134632..2135024(+) (pilA/pilAI) [Xanthomonas sontii strain PPL1]

MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQFEVKKNEGSTLSTPAQIGLASSTTRCTI

AVTDTTIACTLKGNAAKIANKTVTLTRTASTGTWACSSSVDAKYKPTGCS

Nucleotide

Download Length: 393 bp

                                >NTDB_id=868274 RAB70_RS09030 WP_148828476.1 2134632..2135024(+) (pilA/pilAI) [Xanthomonas sontii strain PPL1]

ATGAAGAAGCAGCAGGGCTTTACCCTGATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT

GCCGATGTATCAGGACTACGTCGCCAAGTCGCAGGCCACCGCTGGTCTGGCCGAAATCACCCCGGGCAAGACCCAGTTCG

AGGTGAAGAAGAACGAGGGTAGCACCCTCAGCACGCCGGCCCAGATCGGTTTGGCCTCGAGCACGACCCGTTGCACCATC

GCCGTGACCGACACCACGATTGCCTGCACCCTGAAGGGCAATGCGGCGAAGATCGCCAATAAGACGGTCACTCTGACCCG

TACTGCCAGCACCGGCACCTGGGCTTGCAGCTCGTCGGTCGACGCCAAGTACAAGCCGACCGGCTGCAGCTGA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(35-129)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA/pilAI	Pseudomonas stutzeri DSM 10701	57.778	100	0.6
pilA	Acinetobacter baumannii strain A118	48.921	100	0.523
pilA	Pseudomonas aeruginosa PAK	44.295	100	0.508
pilA/pilAII	Pseudomonas stutzeri DSM 10701	48.872	100	0.5
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	41.667	100	0.462
pilA	Vibrio cholerae strain A1552	41.667	100	0.462
pilA	Vibrio cholerae C6706	41.667	100	0.462
pilA/pilA1	Eikenella corrodens VA1	36.913	100	0.423
comP	Acinetobacter baylyi ADP1	37.931	100	0.423
pilA2	Legionella pneumophila strain ERS1305867	36.552	100	0.408
pilA2	Legionella pneumophila str. Paris	35.862	100	0.4
pilA	Vibrio parahaemolyticus RIMD 2210633	41.935	95.385	0.4
pilA	Ralstonia pseudosolanacearum GMI1000	43.478	88.462	0.385
pilA	Haemophilus influenzae 86-028NP	41.176	91.538	0.377

Detailed information NTG0868274