Detailed information NTG0084499

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: L6410_RS10205
• Genome accession: NZ_AP024276
• Coordinates: 2034888..2035172 (-)
• Length: 94 a.a.
• NCBI ID: WP_172055438.1
• Uniprot ID: -
• Organism: Streptococcus parasuis strain SUT-286
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2029888..2040172

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L6410_RS10170 (SUT286_19900)	-	2030320..2030871 (-)	552	WP_237395448.1	folate family ECF transporter S component	-
L6410_RS10175 (SUT286_19910)	-	2031126..2032313 (-)	1188	WP_237395449.1	acetate kinase	-
L6410_RS10180 (SUT286_19920)	comYH	2032363..2033316 (-)	954	WP_172071572.1	class I SAM-dependent methyltransferase	Machinery gene
L6410_RS10185 (SUT286_19930)	comGG	2033336..2033836 (-)	501	WP_237395452.1	competence type IV pilus minor pilin ComGG	-
L6410_RS10190 (SUT286_19940)	comYF	2033814..2034248 (-)	435	WP_237395454.1	competence type IV pilus minor pilin ComGF	Machinery gene
L6410_RS10195 (SUT286_19950)	comGE	2034235..2034528 (-)	294	WP_237395456.1	competence type IV pilus minor pilin ComGE	-
L6410_RS10200 (SUT286_19960)	comGD	2034500..2034904 (-)	405	WP_172040730.1	competence type IV pilus minor pilin ComGD	-
L6410_RS10205 (SUT286_19970)	comYC	2034888..2035172 (-)	285	WP_172055438.1	competence type IV pilus major pilin ComGC	Machinery gene
L6410_RS10210 (SUT286_19980)	comYB	2035174..2036202 (-)	1029	WP_261311091.1	competence type IV pilus assembly protein ComGB	Machinery gene
L6410_RS10215 (SUT286_19990)	comYA	2036123..2037073 (-)	951	WP_237395458.1	competence type IV pilus ATPase ComGA	Machinery gene
L6410_RS10220 (SUT286_20000)	-	2037161..2038111 (+)	951	WP_237395459.1	S66 family peptidase	-
L6410_RS10225 (SUT286_20010)	-	2038139..2038513 (-)	375	WP_024392660.1	DUF1033 family protein	-

Sequence

Protein

• Length: 94 a.a.
• Molecular weight: 10782.84 Da
• Isoelectric Point: 7.0146

>NTDB_id=84499 L6410_RS10205 WP_172055438.1 2034888..2035172(-) (comYC) [Streptococcus parasuis strain SUT-286]
MKKMLKKKVKGFTLIEMLVVLGIISILLLLFVPNLSKQKQKIQEDGNAAVVKVVESQMDIYELEHGVRPTAEELENLEMI
TEDQLEKYNNVPKK

Nucleotide

• Length: 285 bp

>NTDB_id=84499 L6410_RS10205 WP_172055438.1 2034888..2035172(-) (comYC) [Streptococcus parasuis strain SUT-286]
ATGAAAAAAATGTTGAAAAAGAAAGTCAAAGGATTCACTTTGATCGAAATGTTAGTGGTGCTTGGAATTATTAGTATTCT
CTTGCTGTTATTTGTGCCAAATCTCAGTAAGCAAAAGCAAAAAATACAAGAAGACGGCAATGCGGCGGTTGTAAAAGTTG
TTGAAAGTCAAATGGACATTTACGAATTGGAGCATGGTGTTCGTCCAACAGCAGAAGAATTAGAAAATTTGGAAATGATA
ACTGAAGATCAACTAGAAAAATATAATAATGTACCTAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	63.441	98.936	0.628
comGC/cglC	Streptococcus mitis SK321	55.914	98.936	0.553
comGC	Lactococcus lactis subsp. cremoris KW2	56.667	95.745	0.543
comGC/cglC	Streptococcus pneumoniae Rx1	55.435	97.872	0.543
comGC/cglC	Streptococcus pneumoniae D39	55.435	97.872	0.543
comGC/cglC	Streptococcus pneumoniae R6	55.435	97.872	0.543
comGC/cglC	Streptococcus pneumoniae TIGR4	55.435	97.872	0.543
comGC/cglC	Streptococcus mitis NCTC 12261	55.435	97.872	0.543
comYC	Streptococcus mutans UA140	55.556	95.745	0.532
comYC	Streptococcus mutans UA159	55.556	95.745	0.532
comYC	Streptococcus gordonii str. Challis substr. CH1	55.056	94.681	0.521
comGC	Latilactobacillus sakei subsp. sakei 23K	42.169	88.298	0.372
comGC	Staphylococcus aureus MW2	52.239	71.277	0.372
comGC	Staphylococcus aureus N315	52.239	71.277	0.372
comGC	Bacillus subtilis subsp. subtilis str. 168	45.333	79.787	0.362