NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	PXH68_RS00645	Genome accession	NZ_CP118733
Coordinates	102197..102478 (+)	Length	93 a.a.
NCBI ID	WP_172015368.1	Uniprot ID	A0AA96VCF6
Organism	Streptococcus suivaginalis strain 29896
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 97197..107478

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PXH68_RS00625 (PXH68_00625)	-	98873..99232 (+)	360	WP_105117566.1	DUF1033 family protein	-
PXH68_RS00630 (PXH68_00630)	-	99242..100210 (-)	969	WP_248028796.1	S66 peptidase family protein	-
PXH68_RS00635 (PXH68_00635)	comYA	100296..101234 (+)	939	WP_172015367.1	competence type IV pilus ATPase ComGA	Machinery gene
PXH68_RS00640 (PXH68_00640)	comYB	101158..102195 (+)	1038	WP_248028795.1	competence type IV pilus assembly protein ComGB	Machinery gene
PXH68_RS00645 (PXH68_00645)	comYC	102197..102478 (+)	282	WP_172015368.1	competence type IV pilus major pilin ComGC	Machinery gene
PXH68_RS00650 (PXH68_00650)	comGD	102459..102866 (+)	408	WP_172015369.1	competence type IV pilus minor pilin ComGD	-
PXH68_RS00655 (PXH68_00655)	comYE	102838..103131 (+)	294	WP_024385126.1	competence type IV pilus minor pilin ComGE	Machinery gene
PXH68_RS00660 (PXH68_00660)	comGF/cglF	103118..103552 (+)	435	WP_044676306.1	competence type IV pilus minor pilin ComGF	Machinery gene
PXH68_RS00665 (PXH68_00665)	comGG	103530..104051 (+)	522	WP_172015370.1	competence type IV pilus minor pilin ComGG	-
PXH68_RS00670 (PXH68_00670)	comYH	104101..105054 (+)	954	WP_172015371.1	class I SAM-dependent methyltransferase	Machinery gene
PXH68_RS00675 (PXH68_00675)	-	105105..106292 (+)	1188	WP_172015372.1	acetate kinase	-
PXH68_RS00680 (PXH68_00680)	-	106662..107213 (+)	552	WP_172015373.1	folate family ECF transporter S component	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10449.35 Da Isoelectric Point: 5.8596

                                >NTDB_id=794609 PXH68_RS00645 WP_172015368.1 102197..102478(+) (comYC) [Streptococcus suivaginalis strain 29896]

MKKLIEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKKGNAAVVKVVESQMELYELEHDKEATVADLQAKGYI

TEKQAEQYAEAKQ

Nucleotide

Download Length: 282 bp

                                >NTDB_id=794609 PXH68_RS00645 WP_172015368.1 102197..102478(+) (comYC) [Streptococcus suivaginalis strain 29896]

ATGAAAAAATTAATTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGAATTATTAGCCTGCT

CTTGCTTCTTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGAATGCGGCAGTTGTCAAAGTAG

TGGAAAGCCAGATGGAGCTCTATGAATTGGAACATGACAAGGAAGCAACAGTGGCAGACCTGCAGGCGAAAGGCTATATT

ACTGAAAAACAAGCGGAGCAGTATGCTGAGGCGAAACAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus suis isolate S10	93.548	100	0.935
comGC/cglC	Streptococcus mitis NCTC 12261	62.626	100	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	62.766	100	0.634
comGC/cglC	Streptococcus pneumoniae D39	62.766	100	0.634
comGC/cglC	Streptococcus pneumoniae R6	62.766	100	0.634
comGC/cglC	Streptococcus mitis SK321	62.766	100	0.634
comGC/cglC	Streptococcus pneumoniae TIGR4	62.766	100	0.634
comYC	Streptococcus gordonii str. Challis substr. CH1	62.921	95.699	0.602
comYC	Streptococcus mutans UA140	58.889	96.774	0.57
comYC	Streptococcus mutans UA159	58.889	96.774	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	55.556	96.774	0.538
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398

Detailed information NTG0794609