Detailed information NTG0780038

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: PND17_RS04595
• Genome accession: NZ_CP116772
• Coordinates: 862501..862827 (+)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain strain TSGB 4141
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 857501..867827

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PND17_RS04580 (PND17_04580)	-	860138..860500 (+)	363	WP_087010198.1	DUF1033 family protein	-
PND17_RS04585 (PND17_04585)	comGA/cglA/cilD	860581..861522 (+)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
PND17_RS04590 (PND17_04590)	comYB	861404..862504 (+)	1101	WP_157659050.1	competence type IV pilus assembly protein ComGB	Machinery gene
PND17_RS04595 (PND17_04595)	comYC	862501..862827 (+)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
PND17_RS04600 (PND17_04600)	comYD	862787..863215 (+)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
PND17_RS04605 (PND17_04605)	comGE	863187..863480 (+)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
PND17_RS04610 (PND17_04610)	comYF	863464..863901 (+)	438	WP_022096897.1	competence type IV pilus minor pilin ComGF	Machinery gene
PND17_RS04615 (PND17_04615)	comGG	863879..864196 (+)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
PND17_RS04620 (PND17_04620)	comYH	864241..865197 (+)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
PND17_RS04625 (PND17_04625)	-	865253..866446 (+)	1194	WP_271298286.1	acetate kinase	-
PND17_RS04630 (PND17_04630)	-	866695..866892 (+)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
PND17_RS04635 (PND17_04635)	-	867135..867560 (+)	426	WP_271298285.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=780038 PND17_RS04595 WP_002946126.1 862501..862827(+) (comYC) [Streptococcus thermophilus strain strain TSGB 4141]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=780038 PND17_RS04595 WP_002946126.1 862501..862827(+) (comYC) [Streptococcus thermophilus strain strain TSGB 4141]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTAGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361