Detailed information NTG0718717

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: NWE22_RS09515
• Genome accession: NZ_CP102747
• Coordinates: 1874921..1875199 (-)
• Length: 92 a.a.
• NCBI ID: WP_277745465.1
• Uniprot ID: -
• Organism: Streptococcus parasuis strain SFJ45
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1869921..1880199

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NWE22_RS09480 (NWE22_09480)	-	1870347..1870898 (-)	552	WP_216806342.1	folate family ECF transporter S component	-
NWE22_RS09485 (NWE22_09485)	-	1871153..1872340 (-)	1188	WP_277745461.1	acetate kinase	-
NWE22_RS09490 (NWE22_09490)	comYH	1872390..1873343 (-)	954	WP_277745462.1	class I SAM-dependent methyltransferase	Machinery gene
NWE22_RS09495 (NWE22_09495)	comGG	1873363..1873863 (-)	501	WP_277745463.1	competence type IV pilus minor pilin ComGG	-
NWE22_RS09500 (NWE22_09500)	comYF	1873841..1874275 (-)	435	WP_277745464.1	competence type IV pilus minor pilin ComGF	Machinery gene
NWE22_RS09505 (NWE22_09505)	comGE	1874262..1874555 (-)	294	WP_105126461.1	competence type IV pilus minor pilin ComGE	-
NWE22_RS09510 (NWE22_09510)	comGD	1874527..1874931 (-)	405	WP_160864045.1	competence type IV pilus minor pilin ComGD	-
NWE22_RS09515 (NWE22_09515)	comYC	1874921..1875199 (-)	279	WP_277745465.1	competence type IV pilus major pilin ComGC	Machinery gene
NWE22_RS09520 (NWE22_09520)	comYB	1875201..1876238 (-)	1038	WP_171989705.1	competence type IV pilus assembly protein ComGB	Machinery gene
NWE22_RS09525 (NWE22_09525)	comYA	1876150..1877100 (-)	951	WP_277745466.1	competence type IV pilus ATPase ComGA	Machinery gene
NWE22_RS09530 (NWE22_09530)	-	1877188..1878138 (+)	951	WP_216806334.1	S66 peptidase family protein	-
NWE22_RS09535 (NWE22_09535)	-	1878171..1878539 (-)	369	WP_171989702.1	DUF1033 family protein	-

Sequence

Protein

• Length: 92 a.a.
• Molecular weight: 10558.63 Da
• Isoelectric Point: 9.4264

>NTDB_id=718717 NWE22_RS09515 WP_277745465.1 1874921..1875199(-) (comYC) [Streptococcus parasuis strain SFJ45]
MKKMLKKKVKGFTLIEMLVVLGIISILLLLFVPNLSNQKEVIQKKGDAAIVKIVESQMDIYELDHGVRPTAEELYNQQMI
TKDQLEKYNNVP

Nucleotide

• Length: 279 bp

>NTDB_id=718717 NWE22_RS09515 WP_277745465.1 1874921..1875199(-) (comYC) [Streptococcus parasuis strain SFJ45]
ATGAAAAAAATGTTGAAAAAGAAAGTCAAAGGTTTCACTTTGATCGAAATGTTAGTGGTACTTGGAATTATTAGTATTCT
CTTGCTATTATTTGTGCCAAATCTCAGTAATCAAAAAGAAGTAATTCAGAAGAAAGGGGACGCAGCAATTGTAAAAATTG
TTGAAAGTCAAATGGACATTTACGAATTGGACCATGGTGTTCGCCCAACAGCGGAAGAATTATATAATCAGCAGATGATA
ACAAAAGATCAACTAGAAAAATATAATAATGTACCTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	62.637	98.913	0.62
comGC/cglC	Streptococcus mitis SK321	54.839	100	0.554
comGC	Lactococcus lactis subsp. cremoris KW2	55.556	97.826	0.543
comGC/cglC	Streptococcus mitis NCTC 12261	54.348	100	0.543
comGC/cglC	Streptococcus pneumoniae R6	52.174	100	0.522
comGC/cglC	Streptococcus pneumoniae TIGR4	52.174	100	0.522
comGC/cglC	Streptococcus pneumoniae Rx1	52.174	100	0.522
comGC/cglC	Streptococcus pneumoniae D39	52.174	100	0.522
comYC	Streptococcus mutans UA140	51.111	97.826	0.5
comYC	Streptococcus mutans UA159	51.111	97.826	0.5
comYC	Streptococcus gordonii str. Challis substr. CH1	51.685	96.739	0.5
comGC	Latilactobacillus sakei subsp. sakei 23K	45.783	90.217	0.413
comGC	Bacillus subtilis subsp. subtilis str. 168	48	81.522	0.391
comGC	Staphylococcus aureus N315	50.746	72.826	0.37
comGC	Staphylococcus aureus MW2	50.746	72.826	0.37