Detailed information NTG0058485

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: I872_RS09735
• Genome accession: NC_021175
• Coordinates: 1975342..1975659 (-)
• Length: 105 a.a.
• NCBI ID: WP_015605919.1
• Uniprot ID: -
• Organism: Streptococcus cristatus AS 1.3089
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1970342..1980659

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
I872_RS09705 (I872_09715)	-	1971602..1972798 (-)	1197	Protein_1906	acetate kinase	-
I872_RS09710 (I872_09720)	comYH	1972834..1973799 (-)	966	WP_015605914.1	class I SAM-dependent methyltransferase	Machinery gene
I872_RS09715 (I872_09725)	comGG	1973880..1974287 (-)	408	WP_015605915.1	competence type IV pilus minor pilin ComGG	-
I872_RS09720 (I872_09730)	comGF/cglF	1974268..1974705 (-)	438	WP_015605916.1	competence type IV pilus minor pilin ComGF	Machinery gene
I872_RS09725 (I872_09735)	comGE/cglE	1974689..1974958 (-)	270	WP_015605917.1	competence type IV pilus minor pilin ComGE	Machinery gene
I872_RS09730 (I872_09740)	comYD	1974948..1975382 (-)	435	WP_041826842.1	competence type IV pilus minor pilin ComGD	Machinery gene
I872_RS09735 (I872_09745)	comYC	1975342..1975659 (-)	318	WP_015605919.1	competence type IV pilus major pilin ComGC	Machinery gene
I872_RS09740 (I872_09750)	comYB	1975656..1976672 (-)	1017	WP_015605920.1	competence type IV pilus assembly protein ComGB	Machinery gene
I872_RS09745 (I872_09755)	comYA	1976620..1977561 (-)	942	WP_015605921.1	competence type IV pilus ATPase ComGA	Machinery gene
I872_RS09750 (I872_09760)	-	1977646..1978017 (-)	372	WP_015605922.1	DUF1033 family protein	-
I872_RS09755	-	1978152..1979420 (-)	1269	WP_041826843.1	CapA family protein	-
I872_RS09760 (I872_09770)	comW	1979663..1979890 (-)	228	WP_015605924.1	sigma(X)-activator ComW	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11502.61 Da
• Isoelectric Point: 10.0495

>NTDB_id=58485 I872_RS09735 WP_015605919.1 1975342..1975659(-) (comYC) [Streptococcus cristatus AS 1.3089]
MKKLKALKVKAFTLVEMLVVLLIISVLMLLFVPNLTKQKDTISESGNAAVVKVVESQAELYELKNVNEKATLGKLVADGR
ITDKQVASYKAYYGKNSSEARAVAD

Nucleotide

• Length: 318 bp

>NTDB_id=58485 I872_RS09735 WP_015605919.1 1975342..1975659(-) (comYC) [Streptococcus cristatus AS 1.3089]
ATGAAAAAATTAAAAGCTTTGAAGGTTAAAGCCTTCACTCTGGTGGAAATGTTAGTTGTCCTGTTAATCATCAGCGTCTT
GATGCTCTTGTTTGTTCCGAATTTGACTAAGCAAAAGGATACTATCTCAGAAAGCGGCAATGCGGCCGTAGTCAAGGTGG
TAGAAAGTCAGGCTGAGCTTTATGAATTGAAGAATGTTAATGAAAAAGCTACTCTAGGAAAATTGGTTGCTGATGGTCGG
ATTACCGATAAGCAGGTGGCATCCTATAAGGCTTACTATGGAAAAAACAGTAGTGAAGCTCGTGCAGTTGCGGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	78.095	100	0.781
comGC/cglC	Streptococcus pneumoniae Rx1	67.619	100	0.676
comGC/cglC	Streptococcus pneumoniae D39	67.619	100	0.676
comGC/cglC	Streptococcus pneumoniae R6	67.619	100	0.676
comGC/cglC	Streptococcus pneumoniae TIGR4	67.619	100	0.676
comYC	Streptococcus mutans UA159	66.667	100	0.667
comYC	Streptococcus mutans UA140	66.667	100	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	67.647	97.143	0.657
comGC	Lactococcus lactis subsp. cremoris KW2	56.731	99.048	0.562
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Staphylococcus aureus MW2	48.718	74.286	0.362
comGC	Staphylococcus aureus N315	48.718	74.286	0.362