Detailed information NTG0552950

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: J7U23_RS09025
• Genome accession: NZ_CP072435
• Coordinates: 1747182..1747508 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain S24736
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1742182..1752508

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7U23_RS08985	-	1742449..1742874 (-)	426	WP_111679733.1	CPBP family intramembrane glutamic endopeptidase	-
J7U23_RS08990 (J7U23_08885)	-	1743117..1743314 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
J7U23_RS08995 (J7U23_08890)	-	1743563..1744756 (-)	1194	WP_084831204.1	acetate kinase	-
J7U23_RS09000 (J7U23_08895)	comYH	1744812..1745768 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
J7U23_RS09005 (J7U23_08900)	comGG	1745813..1746130 (-)	318	WP_082309152.1	competence type IV pilus minor pilin ComGG	-
J7U23_RS09010 (J7U23_08905)	comYF	1746108..1746545 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7U23_RS09015 (J7U23_08910)	comGE	1746529..1746822 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
J7U23_RS09020 (J7U23_08915)	comYD	1746794..1747222 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7U23_RS09025 (J7U23_08920)	comYC	1747182..1747508 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7U23_RS09030 (J7U23_08925)	comYB	1747505..1748605 (-)	1101	WP_271307389.1	competence type IV pilus assembly protein ComGB	Machinery gene
J7U23_RS09035 (J7U23_08930)	comYA	1748487..1749428 (-)	942	WP_372589905.1	competence type IV pilus ATPase ComGA	Machinery gene
J7U23_RS09040 (J7U23_08935)	-	1749509..1749871 (-)	363	WP_372433446.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=552950 J7U23_RS09025 WP_002946126.1 1747182..1747508(-) (comYC) [Streptococcus thermophilus strain S24736]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=552950 J7U23_RS09025 WP_002946126.1 1747182..1747508(-) (comYC) [Streptococcus thermophilus strain S24736]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAAGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361