NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	J4854_RS01145	Genome accession	NZ_CP072329
Coordinates	196543..196860 (+)	Length	105 a.a.
NCBI ID	WP_187539705.1	Uniprot ID	-
Organism	Streptococcus lactarius strain CCUG 66490
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 191543..201860

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J4854_RS01125 (J4854_01125)	-	192834..193937 (+)	1104	WP_200772862.1	glycosyl hydrolase family 8	-
J4854_RS01130 (J4854_01130)	-	194166..194555 (+)	390	WP_200772958.1	DUF1033 family protein	-
J4854_RS01135 (J4854_01135)	comYA	194641..195582 (+)	942	WP_200772863.1	competence type IV pilus ATPase ComGA	Machinery gene
J4854_RS01140 (J4854_01140)	comYB	195515..196546 (+)	1032	WP_244967046.1	competence type IV pilus assembly protein ComGB	Machinery gene
J4854_RS01145 (J4854_01145)	comYC	196543..196860 (+)	318	WP_187539705.1	competence type IV pilus major pilin ComGC	Machinery gene
J4854_RS01150 (J4854_01150)	comYD	196850..197254 (+)	405	WP_234700114.1	competence type IV pilus minor pilin ComGD	Machinery gene
J4854_RS01155 (J4854_01155)	comGE	197295..197507 (+)	213	WP_234700115.1	competence type IV pilus minor pilin ComGE	-
J4854_RS01160 (J4854_01160)	comGF/cglF	197497..197949 (+)	453	WP_200772864.1	competence type IV pilus minor pilin ComGF	Machinery gene
J4854_RS01165 (J4854_01165)	comGG	197915..198382 (+)	468	WP_200772865.1	competence type IV pilus minor pilin ComGG	-
J4854_RS01170 (J4854_01170)	comYH	198413..199366 (+)	954	WP_200772866.1	class I SAM-dependent methyltransferase	Machinery gene
J4854_RS01175 (J4854_01175)	-	199418..200611 (+)	1194	WP_200772867.1	acetate kinase	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11623.51 Da Isoelectric Point: 9.6248

                                >NTDB_id=552019 J4854_RS01145 WP_187539705.1 196543..196860(+) (comYC) [Streptococcus lactarius strain CCUG 66490]

MTSLKKYTVKAFTLIEMLVVLLIISVLLLLFVPNLTKQKDSVKETGNAAVVKVVESQAELYELNHTNDKASLSKLISEGN

ITKKQADSYRAYYAKNSGETRAVAD

Nucleotide

Download Length: 318 bp

                                >NTDB_id=552019 J4854_RS01145 WP_187539705.1 196543..196860(+) (comYC) [Streptococcus lactarius strain CCUG 66490]

ATGACATCATTAAAAAAATATACGGTAAAGGCGTTCACGCTGATTGAAATGCTGGTGGTTTTATTGATCATCAGTGTCCT

ATTGTTGCTCTTCGTGCCAAATTTGACCAAACAAAAAGACTCTGTGAAAGAAACAGGAAATGCAGCGGTTGTCAAGGTGG

TCGAAAGTCAGGCAGAACTCTATGAACTCAATCATACTAACGATAAGGCCAGCTTATCAAAACTTATTTCTGAAGGCAAT

ATTACCAAAAAACAAGCAGACTCTTATCGTGCTTATTATGCGAAAAATAGTGGAGAAACACGTGCGGTTGCAGATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(10-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus gordonii str. Challis substr. CH1	75.238	100	0.752
comYC	Streptococcus mutans UA159	70.476	100	0.705
comYC	Streptococcus mutans UA140	70.476	100	0.705
comGC/cglC	Streptococcus mitis SK321	70.476	100	0.705
comGC/cglC	Streptococcus mitis NCTC 12261	68.868	100	0.695
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	100	0.667
comGC/cglC	Streptococcus pneumoniae R6	66.667	100	0.667
comGC/cglC	Streptococcus pneumoniae D39	66.667	100	0.667
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	100	0.667
comGC	Lactococcus lactis subsp. cremoris KW2	64.583	91.429	0.59
comYC	Streptococcus suis isolate S10	60.674	84.762	0.514
comGC	Staphylococcus aureus N315	51.22	78.095	0.4
comGC	Staphylococcus aureus MW2	51.22	78.095	0.4

Detailed information NTG0552019