NTDB

Overview

Name	pilA2	Type	Machinery gene
Locus tag	GKQ51_RS05040	Genome accession	NZ_CP066310
Coordinates	1079991..1080437 (+)	Length	148 a.a.
NCBI ID	WP_198867369.1	Uniprot ID	A0AAP9YHW4
Organism	Azotobacter chroococcum strain HR1
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1074991..1085437

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GKQ51_RS05025 (GKQ51_05025)	pilD	1075225..1076094 (-)	870	WP_089167359.1	prepilin peptidase	Machinery gene
GKQ51_RS05030 (GKQ51_05030)	pilC	1076097..1077314 (-)	1218	WP_089169794.1	type II secretion system F family protein	Machinery gene
GKQ51_RS05035 (GKQ51_05035)	pilB	1077739..1079439 (-)	1701	WP_198867368.1	type IV-A pilus assembly ATPase PilB	Machinery gene
GKQ51_RS05040 (GKQ51_05040)	pilA2	1079991..1080437 (+)	447	WP_198867369.1	pilin	Machinery gene
GKQ51_RS05045 (GKQ51_05045)	-	1080644..1081186 (+)	543	WP_198867370.1	REP-associated tyrosine transposase	-
GKQ51_RS05050 (GKQ51_05050)	-	1081222..1081608 (-)	387	WP_198867371.1	type II toxin-antitoxin system VapC family toxin	-
GKQ51_RS05055 (GKQ51_05055)	-	1081605..1081850 (-)	246	WP_198867372.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
GKQ51_RS05060 (GKQ51_05060)	nadC	1082097..1082945 (-)	849	WP_131300091.1	carboxylating nicotinate-nucleotide diphosphorylase	-
GKQ51_RS05065 (GKQ51_05065)	ampD	1083098..1083661 (+)	564	WP_039805672.1	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	-
GKQ51_RS05070 (GKQ51_05070)	ampE	1083658..1084500 (+)	843	WP_198867373.1	regulatory signaling modulator protein AmpE	-
GKQ51_RS05075 (GKQ51_05075)	-	1084639..1085421 (-)	783	WP_198867374.1	TatD family hydrolase	-

Sequence

Protein

Download Length: 148 a.a. Molecular weight: 14682.90 Da Isoelectric Point: 8.4771

                                >NTDB_id=519245 GKQ51_RS05040 WP_198867369.1 1079991..1080437(+) (pilA2) [Azotobacter chroococcum strain HR1]

MKAQMQKGFTLIELMIVVAIIGILAAVALPAYQDYTVRAKVSEGLVLATGAKVTVSENAANGKNFDAGYTAPAATASIAS

VGITQATGVVTVTTTAALGGGTIIFTPTSAGVALAGDATSSTVPAGGSIEWSCTAGTLAAKYRPAQCR

Nucleotide

Download Length: 447 bp

                                >NTDB_id=519245 GKQ51_RS05040 WP_198867369.1 1079991..1080437(+) (pilA2) [Azotobacter chroococcum strain HR1]

ATGAAAGCGCAAATGCAGAAAGGTTTTACCCTGATTGAATTGATGATCGTGGTAGCGATCATCGGTATTCTGGCTGCCGT

CGCACTGCCGGCTTATCAGGATTACACTGTTCGGGCAAAAGTCTCTGAAGGCTTGGTGCTGGCTACCGGTGCGAAGGTGA

CTGTTTCCGAAAATGCTGCGAACGGCAAAAATTTTGATGCTGGCTACACCGCTCCGGCCGCTACTGCCAGTATCGCATCT

GTCGGAATCACTCAAGCTACTGGTGTTGTAACCGTTACTACGACTGCTGCTCTTGGCGGTGGAACTATTATCTTTACTCC

AACATCTGCTGGCGTCGCCTTGGCAGGTGATGCAACGTCTTCGACTGTCCCTGCCGGCGGGTCGATCGAGTGGTCCTGTA

CTGCTGGTACGCTCGCCGCCAAGTATCGTCCGGCCCAATGCCGGTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(37-148)

Prokaryotic N-terminal methylation motif (N_methyl)

(6-29)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA2	Legionella pneumophila str. Paris	57.432	100	0.574
pilA2	Legionella pneumophila strain ERS1305867	57.432	100	0.574
pilA	Ralstonia pseudosolanacearum GMI1000	48.503	100	0.547
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	39.796	100	0.527
pilA/pilAI	Pseudomonas stutzeri DSM 10701	45.395	100	0.466
comP	Acinetobacter baylyi ADP1	47.586	97.973	0.466
pilE	Neisseria gonorrhoeae MS11	38.554	100	0.432
pilE	Neisseria gonorrhoeae strain FA1090	36.364	100	0.405
pilA/pilA1	Eikenella corrodens VA1	35.928	100	0.405
pilA	Pseudomonas aeruginosa PAK	36.842	100	0.378
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.007	95.27	0.372
pilA	Vibrio parahaemolyticus RIMD 2210633	39.416	92.568	0.365

Detailed information NTG0519245