Detailed information NTG0516282

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: I6H54_RS30195
• Genome accession: NZ_CP066006
• Coordinates: 6644825..6645268 (-)
• Length: 147 a.a.
• NCBI ID: WP_034389792.1
• Uniprot ID: -
• Organism: Delftia acidovorans strain FDAARGOS_997
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	6631299..6644759	6644825..6645268	flank	66

Gene organization within MGE regions

Location: 6631299..6645268

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
I6H54_RS30145 (I6H54_30145)	-	6631650..6632918 (+)	1269	WP_162269879.1	oligosaccharide flippase family protein	-
I6H54_RS30150 (I6H54_30150)	-	6632902..6633642 (+)	741	WP_080736784.1	class I SAM-dependent methyltransferase	-
I6H54_RS30155 (I6H54_30155)	-	6633749..6635041 (+)	1293	WP_155294166.1	hypothetical protein	-
I6H54_RS30160 (I6H54_30160)	-	6635170..6636417 (+)	1248	WP_080736785.1	glycosyltransferase	-
I6H54_RS30165 (I6H54_30165)	-	6636436..6638448 (+)	2013	WP_155294167.1	hypothetical protein	-
I6H54_RS30170 (I6H54_30170)	glf	6638481..6639578 (+)	1098	WP_230590700.1	UDP-galactopyranose mutase	-
I6H54_RS30175 (I6H54_30175)	-	6639586..6640734 (+)	1149	WP_198488078.1	glycosyltransferase family 4 protein	-
I6H54_RS30180 (I6H54_30180)	-	6640739..6641956 (-)	1218	WP_034389790.1	glycosyltransferase	-
I6H54_RS30185 (I6H54_30185)	-	6641953..6642804 (-)	852	WP_034389791.1	glycosyltransferase family 2 protein	-
I6H54_RS30190 (I6H54_30190)	-	6642801..6644759 (-)	1959	WP_174549395.1	tetratricopeptide repeat protein	-
I6H54_RS30195 (I6H54_30195)	pilA2	6644825..6645268 (-)	444	WP_034389792.1	pilin	Machinery gene

Sequence

Protein

• Length: 147 a.a.
• Molecular weight: 15318.61 Da
• Isoelectric Point: 9.8522

>NTDB_id=516282 I6H54_RS30195 WP_034389792.1 6644825..6645268(-) (pilA2) [Delftia acidovorans strain FDAARGOS_997]
MKRSIQQGFTLIELMIVVAIIGILAAVALPAYQDYTVRSKVSEGLTLAASAKTAVSEHRLSQGTWPATSAAAGYTSPNTK
YVSGITIQDGLITITYKTGSSGSGVASGNDKLVLSALSVVGAVDWKCKRPAANPVDAKYLPANCRQS

Nucleotide

• Length: 444 bp

>NTDB_id=516282 I6H54_RS30195 WP_034389792.1 6644825..6645268(-) (pilA2) [Delftia acidovorans strain FDAARGOS_997]
ATGAAGCGTTCCATCCAGCAAGGTTTTACCTTGATCGAATTGATGATCGTTGTGGCGATCATCGGCATTTTGGCAGCCGT
TGCGCTGCCGGCTTATCAGGATTACACGGTGCGTTCCAAAGTGTCGGAAGGCCTGACCCTGGCAGCCTCTGCCAAGACCG
CCGTCTCGGAGCACCGTCTGAGCCAAGGCACCTGGCCCGCCACCAGCGCTGCTGCTGGCTACACTTCCCCCAACACAAAG
TATGTGAGCGGCATCACCATTCAAGATGGCTTGATTACCATCACATACAAGACAGGCTCTTCCGGCTCTGGCGTTGCTAG
CGGCAATGACAAGCTGGTGCTCTCGGCTCTGTCGGTTGTCGGTGCCGTGGACTGGAAGTGCAAGCGCCCTGCCGCCAACC
CTGTGGATGCCAAGTACCTGCCGGCCAACTGCCGCCAGAGCTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (37-145)

• Prokaryotic N-terminal methylation motif (N_methyl) (4-29)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila str. Paris	53.521	96.599	0.517
pilA2	Legionella pneumophila strain ERS1305867	53.521	96.599	0.517
pilA	Ralstonia pseudosolanacearum GMI1000	44.91	100	0.51
pilE	Neisseria gonorrhoeae MS11	43.75	100	0.476
pilE	Neisseria gonorrhoeae strain FA1090	43.478	100	0.476
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	36.17	100	0.463
comP	Acinetobacter baylyi ADP1	44.218	100	0.442
pilA/pilAI	Pseudomonas stutzeri DSM 10701	43.624	100	0.442
pilA/pilA1	Eikenella corrodens VA1	38.217	100	0.408
pilA/pilAII	Pseudomonas stutzeri DSM 10701	38.255	100	0.388
pilA	Vibrio cholerae C6706	37.333	100	0.381
pilA	Vibrio cholerae strain A1552	37.333	100	0.381
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.333	100	0.381
pilA	Vibrio campbellii strain DS40M4	36.424	100	0.374
pilA	Acinetobacter baumannii strain A118	36.486	100	0.367