Detailed information NTG0494190

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: IM723_RS08970
• Genome accession: NZ_CP063275
• Coordinates: 1739888..1740214 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain DMST-H2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1734888..1745214

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IM723_RS10130	-	1735156..1735494 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
IM723_RS08935	-	1735823..1736020 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
IM723_RS08940	-	1736269..1737462 (-)	1194	WP_014608740.1	acetate kinase	-
IM723_RS08945	comYH	1737518..1738474 (-)	957	WP_211836898.1	class I SAM-dependent methyltransferase	Machinery gene
IM723_RS08950	comGG	1738519..1738836 (-)	318	WP_141326604.1	competence type IV pilus minor pilin ComGG	-
IM723_RS08955	comYF	1738814..1739251 (-)	438	WP_022096897.1	competence type IV pilus minor pilin ComGF	Machinery gene
IM723_RS08960	comGE	1739235..1739528 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
IM723_RS08965	comYD	1739500..1739928 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
IM723_RS08970	comYC	1739888..1740214 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
IM723_RS08975	comYB	1740211..1741311 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
IM723_RS08980	comGA/cglA/cilD	1741193..1742134 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
IM723_RS08985	-	1742215..1742577 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=494190 IM723_RS08970 WP_002946126.1 1739888..1740214(-) (comYC) [Streptococcus thermophilus strain DMST-H2]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=494190 IM723_RS08970 WP_002946126.1 1739888..1740214(-) (comYC) [Streptococcus thermophilus strain DMST-H2]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361