Detailed information NTG0453520

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: FOC72_RS09180
• Genome accession: NZ_CP054570
• Coordinates: 1915865..1916182 (-)
• Length: 105 a.a.
• NCBI ID: WP_002896769.1
• Uniprot ID: F3SKF6
• Organism: Streptococcus sanguinis strain FDAARGOS_770
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1910865..1921182

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FOC72_RS09145 (FOC72_09145)	-	1911248..1911997 (-)	750	WP_002896762.1	CPBP family intramembrane glutamic endopeptidase	-
FOC72_RS09150 (FOC72_09150)	-	1912141..1913334 (-)	1194	WP_002896763.1	acetate kinase	-
FOC72_RS09155 (FOC72_09155)	comYH	1913371..1914336 (-)	966	WP_002896764.1	class I SAM-dependent methyltransferase	Machinery gene
FOC72_RS09160 (FOC72_09160)	comGG	1914418..1914810 (-)	393	WP_002896765.1	competence type IV pilus minor pilin ComGG	-
FOC72_RS09165 (FOC72_09165)	comGF/cglF	1914791..1915228 (-)	438	WP_002896766.1	competence type IV pilus minor pilin ComGF	Machinery gene
FOC72_RS09170 (FOC72_09170)	comGE/cglE	1915212..1915445 (-)	234	WP_002896767.1	competence type IV pilus minor pilin ComGE	Machinery gene
FOC72_RS09175 (FOC72_09175)	comYD	1915471..1915905 (-)	435	WP_032914279.1	competence type IV pilus minor pilin ComGD	Machinery gene
FOC72_RS09180 (FOC72_09180)	comYC	1915865..1916182 (-)	318	WP_002896769.1	competence type IV pilus major pilin ComGC	Machinery gene
FOC72_RS09185 (FOC72_09185)	comYB	1916182..1917216 (-)	1035	WP_270623281.1	competence type IV pilus assembly protein ComGB	Machinery gene
FOC72_RS09190 (FOC72_09190)	comYA	1917146..1918087 (-)	942	WP_002896773.1	competence type IV pilus ATPase ComGA	Machinery gene
FOC72_RS09195 (FOC72_09195)	-	1918217..1918597 (-)	381	WP_002896774.1	DUF1033 family protein	-
FOC72_RS09200 (FOC72_09200)	-	1918623..1918850 (-)	228	WP_002896775.1	hypothetical protein	-
FOC72_RS09205 (FOC72_09205)	-	1919016..1920122 (-)	1107	WP_002896776.1	glycosyl hydrolase family 8	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11400.28 Da
• Isoelectric Point: 9.6959

>NTDB_id=453520 FOC72_RS09180 WP_002896769.1 1915865..1916182(-) (comYC) [Streptococcus sanguinis strain FDAARGOS_770]
MKKLNTLKVQAFTLVEMLIVLLVISVLLLLFVPNLTKQKDAVSDTGTAAVVKVVESQAELYELKNTNEKASLSKLVSAGN
ISQKQADSYKAYYGKHSGETQAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=453520 FOC72_RS09180 WP_002896769.1 1915865..1916182(-) (comYC) [Streptococcus sanguinis strain FDAARGOS_770]
ATGAAAAAACTTAATACCTTAAAAGTTCAAGCATTTACCCTTGTGGAAATGCTGATTGTCTTGCTGGTTATCAGCGTTCT
CTTGCTGCTCTTTGTGCCTAATCTGACCAAGCAAAAAGATGCTGTTTCAGATACAGGAACTGCAGCGGTGGTCAAGGTGG
TAGAAAGCCAGGCAGAGCTGTATGAATTGAAGAATACCAATGAAAAGGCTAGCCTGAGCAAGCTAGTCAGCGCAGGAAAT
ATCAGCCAGAAGCAGGCAGATTCATATAAGGCTTACTATGGAAAACACAGTGGCGAAACTCAAGCGGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-30)

3D structure

• AlphaFold DB: F3SKF6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	82.857	100	0.829
comYC	Streptococcus mutans UA159	68.571	100	0.686
comYC	Streptococcus mutans UA140	68.571	100	0.686
comGC/cglC	Streptococcus mitis NCTC 12261	65.138	100	0.676
comGC/cglC	Streptococcus mitis SK321	65.421	100	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	63.551	100	0.648
comGC/cglC	Streptococcus pneumoniae D39	63.551	100	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	63.551	100	0.648
comGC/cglC	Streptococcus pneumoniae R6	63.551	100	0.648
comGC	Lactococcus lactis subsp. cremoris KW2	59	95.238	0.562
comYC	Streptococcus suis isolate S10	61.798	84.762	0.524
comGC	Staphylococcus aureus MW2	43.878	93.333	0.41
comGC	Staphylococcus aureus N315	43.878	93.333	0.41