Detailed information
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | FOC72_RS09180 | Genome accession | NZ_CP054570 |
| Coordinates | 1915865..1916182 (-) | Length | 105 a.a. |
| NCBI ID | WP_002896769.1 | Uniprot ID | F3SKF6 |
| Organism | Streptococcus sanguinis strain FDAARGOS_770 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1910865..1921182
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOC72_RS09145 (FOC72_09145) | - | 1911248..1911997 (-) | 750 | WP_002896762.1 | CPBP family intramembrane glutamic endopeptidase | - |
| FOC72_RS09150 (FOC72_09150) | - | 1912141..1913334 (-) | 1194 | WP_002896763.1 | acetate kinase | - |
| FOC72_RS09155 (FOC72_09155) | comYH | 1913371..1914336 (-) | 966 | WP_002896764.1 | class I SAM-dependent methyltransferase | Machinery gene |
| FOC72_RS09160 (FOC72_09160) | comGG | 1914418..1914810 (-) | 393 | WP_002896765.1 | competence type IV pilus minor pilin ComGG | - |
| FOC72_RS09165 (FOC72_09165) | comGF/cglF | 1914791..1915228 (-) | 438 | WP_002896766.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| FOC72_RS09170 (FOC72_09170) | comGE/cglE | 1915212..1915445 (-) | 234 | WP_002896767.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| FOC72_RS09175 (FOC72_09175) | comYD | 1915471..1915905 (-) | 435 | WP_032914279.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| FOC72_RS09180 (FOC72_09180) | comYC | 1915865..1916182 (-) | 318 | WP_002896769.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| FOC72_RS09185 (FOC72_09185) | comYB | 1916182..1917216 (-) | 1035 | WP_270623281.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| FOC72_RS09190 (FOC72_09190) | comYA | 1917146..1918087 (-) | 942 | WP_002896773.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| FOC72_RS09195 (FOC72_09195) | - | 1918217..1918597 (-) | 381 | WP_002896774.1 | DUF1033 family protein | - |
| FOC72_RS09200 (FOC72_09200) | - | 1918623..1918850 (-) | 228 | WP_002896775.1 | hypothetical protein | - |
| FOC72_RS09205 (FOC72_09205) | - | 1919016..1920122 (-) | 1107 | WP_002896776.1 | glycosyl hydrolase family 8 | - |
Sequence
Protein
Download Length: 105 a.a. Molecular weight: 11400.28 Da Isoelectric Point: 9.6959
>NTDB_id=453520 FOC72_RS09180 WP_002896769.1 1915865..1916182(-) (comYC) [Streptococcus sanguinis strain FDAARGOS_770]
MKKLNTLKVQAFTLVEMLIVLLVISVLLLLFVPNLTKQKDAVSDTGTAAVVKVVESQAELYELKNTNEKASLSKLVSAGN
ISQKQADSYKAYYGKHSGETQAVAN
MKKLNTLKVQAFTLVEMLIVLLVISVLLLLFVPNLTKQKDAVSDTGTAAVVKVVESQAELYELKNTNEKASLSKLVSAGN
ISQKQADSYKAYYGKHSGETQAVAN
Nucleotide
Download Length: 318 bp
>NTDB_id=453520 FOC72_RS09180 WP_002896769.1 1915865..1916182(-) (comYC) [Streptococcus sanguinis strain FDAARGOS_770]
ATGAAAAAACTTAATACCTTAAAAGTTCAAGCATTTACCCTTGTGGAAATGCTGATTGTCTTGCTGGTTATCAGCGTTCT
CTTGCTGCTCTTTGTGCCTAATCTGACCAAGCAAAAAGATGCTGTTTCAGATACAGGAACTGCAGCGGTGGTCAAGGTGG
TAGAAAGCCAGGCAGAGCTGTATGAATTGAAGAATACCAATGAAAAGGCTAGCCTGAGCAAGCTAGTCAGCGCAGGAAAT
ATCAGCCAGAAGCAGGCAGATTCATATAAGGCTTACTATGGAAAACACAGTGGCGAAACTCAAGCGGTTGCCAATTAA
ATGAAAAAACTTAATACCTTAAAAGTTCAAGCATTTACCCTTGTGGAAATGCTGATTGTCTTGCTGGTTATCAGCGTTCT
CTTGCTGCTCTTTGTGCCTAATCTGACCAAGCAAAAAGATGCTGTTTCAGATACAGGAACTGCAGCGGTGGTCAAGGTGG
TAGAAAGCCAGGCAGAGCTGTATGAATTGAAGAATACCAATGAAAAGGCTAGCCTGAGCAAGCTAGTCAGCGCAGGAAAT
ATCAGCCAGAAGCAGGCAGATTCATATAAGGCTTACTATGGAAAACACAGTGGCGAAACTCAAGCGGTTGCCAATTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
82.857 |
100 |
0.829 |
| comYC | Streptococcus mutans UA159 |
68.571 |
100 |
0.686 |
| comYC | Streptococcus mutans UA140 |
68.571 |
100 |
0.686 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
65.138 |
100 |
0.676 |
| comGC/cglC | Streptococcus mitis SK321 |
65.421 |
100 |
0.667 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.551 |
100 |
0.648 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.551 |
100 |
0.648 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.551 |
100 |
0.648 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.551 |
100 |
0.648 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
59 |
95.238 |
0.562 |
| comYC | Streptococcus suis isolate S10 |
61.798 |
84.762 |
0.524 |
| comGC | Staphylococcus aureus MW2 |
43.878 |
93.333 |
0.41 |
| comGC | Staphylococcus aureus N315 |
43.878 |
93.333 |
0.41 |