Detailed information NTG0040785

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: PSEFU_RS22965
• Genome accession: NC_015556
• Coordinates: 4091196..4091612 (-)
• Length: 138 a.a.
• NCBI ID: WP_420042201.1
• Uniprot ID: -
• Organism: Pseudomonas fulva 12-X
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	4081569..4091171	4091196..4091612	flank	25

Gene organization within MGE regions

Location: 4081569..4091612

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PSEFU_RS18920 (Psefu_3782)	-	4081671..4082741 (+)	1071	WP_232285999.1	glycosyltransferase family 4 protein	-
PSEFU_RS18925 (Psefu_3783)	-	4082816..4083694 (+)	879	WP_198136651.1	glycosyltransferase	-
PSEFU_RS18930 (Psefu_3784)	-	4083691..4084734 (+)	1044	WP_013792864.1	class I SAM-dependent methyltransferase	-
PSEFU_RS22960 (Psefu_3785)	-	4084739..4085668 (+)	930	WP_013792865.1	glycosyltransferase	-
PSEFU_RS18940 (Psefu_3786)	-	4085594..4086859 (-)	1266	WP_013792866.1	lipopolysaccharide biosynthesis protein	-
PSEFU_RS18945	-	4086862..4087512 (-)	651	WP_049792729.1	ATP-binding protein	-
PSEFU_RS22590	-	4087593..4088000 (-)	408	WP_157139357.1	hypothetical protein	-
PSEFU_RS23690	-	4087942..4088211 (-)	270	WP_157139399.1	ATP-binding protein	-
PSEFU_RS18955 (Psefu_3788)	-	4088365..4089216 (-)	852	WP_013792867.1	glycosyltransferase family 2 protein	-
PSEFU_RS18960 (Psefu_3789)	-	4089213..4091171 (-)	1959	WP_013792868.1	tetratricopeptide repeat protein	-
PSEFU_RS22965 (Psefu_3790)	pilA	4091196..4091612 (-)	417	WP_420042201.1	pilin	Machinery gene

Sequence

Protein

• Length: 138 a.a.
• Molecular weight: 14204.26 Da
• Isoelectric Point: 9.9364

>NTDB_id=40785 PSEFU_RS22965 WP_420042201.1 4091196..4091612(-) (pilA) [Pseudomonas fulva 12-X]
MQKGFTLIELMIVVAIIGILAAIALPAYQDYTKRSHVSEGLSLAGGAKASVSEFLSSNNRYPTNNASAGLATNTSITGNA
VTSVTVANGLITIAFNDKVSSGATLALSPTTNAGGIRWKCKPGASTPIDTKFIPSNCR

Nucleotide

• Length: 417 bp

>NTDB_id=40785 PSEFU_RS22965 WP_420042201.1 4091196..4091612(-) (pilA) [Pseudomonas fulva 12-X]
ATGCAAAAGGGTTTTACCCTGATTGAATTGATGATCGTTGTTGCGATCATCGGTATTTTGGCTGCCATTGCGCTGCCTGC
TTACCAGGATTACACCAAGCGTTCTCACGTTTCCGAAGGCCTGAGCCTCGCTGGTGGTGCCAAGGCTTCCGTATCCGAGT
TCTTGTCCAGCAACAATCGTTATCCTACGAACAATGCCTCCGCTGGGCTGGCTACCAATACGTCCATCACAGGCAATGCT
GTTACTAGCGTTACTGTTGCGAATGGCCTTATCACCATCGCTTTTAATGATAAGGTATCCAGTGGCGCTACCTTGGCGCT
GAGTCCAACTACTAATGCTGGTGGTATTCGCTGGAAATGCAAGCCAGGCGCCAGCACTCCGATCGATACAAAATTCATTC
CTTCGAACTGCCGATAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (34-138)

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Ralstonia pseudosolanacearum GMI1000	42.262	100	0.514
pilE	Neisseria gonorrhoeae MS11	44.654	100	0.514
pilE	Neisseria gonorrhoeae strain FA1090	43.871	100	0.493
pilA2	Legionella pneumophila str. Paris	49.275	100	0.493
pilA2	Legionella pneumophila strain ERS1305867	49.275	100	0.493
comP	Acinetobacter baylyi ADP1	43.537	100	0.464
pilA/pilA1	Eikenella corrodens VA1	41.06	100	0.449
pilA/pilAI	Pseudomonas stutzeri DSM 10701	41.667	100	0.435
pilA	Haemophilus influenzae 86-028NP	40.845	100	0.42
pilA	Pseudomonas aeruginosa PAK	37.013	100	0.413
pilA	Vibrio campbellii strain DS40M4	35.948	100	0.399
pilA	Haemophilus influenzae Rd KW20	36.691	100	0.37
pilA/pilAII	Pseudomonas stutzeri DSM 10701	36.691	100	0.37
pilA	Acinetobacter baumannii strain A118	35.915	100	0.37