Detailed information NTG0406293

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GPA00_RS03640
• Genome accession: NZ_CP046629
• Coordinates: 707934..708236 (+)
• Length: 100 a.a.
• NCBI ID: WP_021141433.1
• Uniprot ID: -
• Organism: Streptococcus equinus strain CNU G6
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 702934..713236

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GPA00_RS03625 (GPA00_03625)	-	705589..705957 (+)	369	WP_094140982.1	DUF1033 family protein	-
GPA00_RS03630 (GPA00_03630)	comYA	706026..706967 (+)	942	WP_027968018.1	competence type IV pilus ATPase ComGA	Machinery gene
GPA00_RS03635 (GPA00_03635)	comYB	706891..707934 (+)	1044	WP_167697815.1	competence type IV pilus assembly protein ComGB	Machinery gene
GPA00_RS03640 (GPA00_03640)	comYC	707934..708236 (+)	303	WP_021141433.1	competence type IV pilus major pilin ComGC	Machinery gene
GPA00_RS03645 (GPA00_03645)	comGD	708211..708651 (+)	441	WP_157327520.1	competence type IV pilus minor pilin ComGD	-
GPA00_RS03650 (GPA00_03650)	comYE	708605..708898 (+)	294	WP_074629067.1	competence type IV pilus minor pilin ComGE	Machinery gene
GPA00_RS03655 (GPA00_03655)	comYF	708882..709319 (+)	438	WP_157327522.1	competence type IV pilus minor pilin ComGF	Machinery gene
GPA00_RS03660 (GPA00_03660)	comGG	709348..709641 (+)	294	WP_268894141.1	competence type IV pilus minor pilin ComGG	-
GPA00_RS03665 (GPA00_03665)	comYH	709695..710651 (+)	957	WP_024344497.1	class I SAM-dependent methyltransferase	Machinery gene
GPA00_RS03670 (GPA00_03670)	-	710705..711904 (+)	1200	WP_045798327.1	acetate kinase	-
GPA00_RS03675 (GPA00_03675)	-	712062..712259 (+)	198	WP_027968026.1	helix-turn-helix transcriptional regulator	-
GPA00_RS03680 (GPA00_03680)	-	712315..712767 (+)	453	WP_074483978.1	ABC transporter permease	-

Sequence

Protein

• Length: 100 a.a.
• Molecular weight: 11429.64 Da
• Isoelectric Point: 10.1648

>NTDB_id=406293 GPA00_RS03640 WP_021141433.1 707934..708236(+) (comYC) [Streptococcus equinus strain CNU G6]
MKKLWKKLRKKSVEAFTLVEMLIVLLIIGVLMLLFVPNLSKQKEAIHEKGDAAVVKVVESQKELYEVKTGKEATIKDLVK
EGYISQQQAQTYNEKAKPKE

Nucleotide

• Length: 303 bp

>NTDB_id=406293 GPA00_RS03640 WP_021141433.1 707934..708236(+) (comYC) [Streptococcus equinus strain CNU G6]
ATGAAAAAACTATGGAAAAAATTACGTAAAAAATCTGTTGAAGCTTTCACACTTGTGGAGATGTTGATTGTCCTGTTAAT
TATCGGTGTTTTGATGCTTTTATTTGTACCGAATTTGAGTAAGCAAAAAGAGGCGATTCATGAAAAAGGTGATGCAGCTG
TTGTGAAAGTTGTCGAAAGTCAGAAAGAACTTTACGAAGTTAAAACAGGTAAAGAAGCAACTATTAAAGATTTGGTGAAA
GAAGGCTATATTTCACAACAACAAGCTCAAACGTATAATGAAAAAGCTAAACCTAAAGAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (13-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	68.539	89	0.61
comGC/cglC	Streptococcus mitis SK321	60.638	94	0.57
comYC	Streptococcus suis isolate S10	63.636	88	0.56
comGC/cglC	Streptococcus pneumoniae D39	59.574	94	0.56
comGC/cglC	Streptococcus pneumoniae R6	59.574	94	0.56
comGC/cglC	Streptococcus pneumoniae TIGR4	59.574	94	0.56
comGC/cglC	Streptococcus mitis NCTC 12261	59.574	94	0.56
comGC/cglC	Streptococcus pneumoniae Rx1	59.574	94	0.56
comYC	Streptococcus mutans UA140	57.303	89	0.51
comYC	Streptococcus mutans UA159	57.303	89	0.51
comGC	Lactococcus lactis subsp. cremoris KW2	50	90	0.45
comGC	Staphylococcus aureus MW2	44.186	86	0.38
comGC	Staphylococcus aureus N315	44.186	86	0.38