Detailed information NTG0406225

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GO596_RS02335
• Genome accession: NZ_CP046628
• Coordinates: 478762..479064 (-)
• Length: 100 a.a.
• NCBI ID: WP_021141433.1
• Uniprot ID: -
• Organism: Streptococcus equinus strain CNU 77-23
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 473762..484064

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GO596_RS02295 (GO596_02295)	-	474231..474683 (-)	453	WP_157339146.1	ABC transporter permease	-
GO596_RS02300 (GO596_02300)	-	474739..474936 (-)	198	WP_027968026.1	helix-turn-helix transcriptional regulator	-
GO596_RS02305 (GO596_02305)	-	475094..476293 (-)	1200	WP_045798327.1	acetate kinase	-
GO596_RS02310 (GO596_02310)	comYH	476347..477303 (-)	957	WP_157339147.1	class I SAM-dependent methyltransferase	Machinery gene
GO596_RS02315 (GO596_02315)	comGG	477357..477692 (-)	336	WP_198362600.1	competence type IV pilus minor pilin ComGG	-
GO596_RS02320 (GO596_02320)	comYF	477679..478116 (-)	438	WP_157339148.1	competence type IV pilus minor pilin ComGF	Machinery gene
GO596_RS02325 (GO596_02325)	comYE	478100..478393 (-)	294	WP_157339149.1	competence type IV pilus minor pilin ComGE	Machinery gene
GO596_RS02330 (GO596_02330)	comGD	478347..478787 (-)	441	WP_074534076.1	competence type IV pilus minor pilin ComGD	-
GO596_RS02335 (GO596_02335)	comYC	478762..479064 (-)	303	WP_021141433.1	competence type IV pilus major pilin ComGC	Machinery gene
GO596_RS02340 (GO596_02340)	comYB	479064..480107 (-)	1044	WP_198289264.1	competence type IV pilus assembly protein ComGB	Machinery gene
GO596_RS02345 (GO596_02345)	comYA	480031..480972 (-)	942	WP_027968018.1	competence type IV pilus ATPase ComGA	Machinery gene
GO596_RS02350 (GO596_02350)	-	481041..481409 (-)	369	WP_021141429.1	DUF1033 family protein	-

Sequence

Protein

• Length: 100 a.a.
• Molecular weight: 11429.64 Da
• Isoelectric Point: 10.1648

>NTDB_id=406225 GO596_RS02335 WP_021141433.1 478762..479064(-) (comYC) [Streptococcus equinus strain CNU 77-23]
MKKLWKKLRKKSVEAFTLVEMLIVLLIIGVLMLLFVPNLSKQKEAIHEKGDAAVVKVVESQKELYEVKTGKEATIKDLVK
EGYISQQQAQTYNEKAKPKE

Nucleotide

• Length: 303 bp

>NTDB_id=406225 GO596_RS02335 WP_021141433.1 478762..479064(-) (comYC) [Streptococcus equinus strain CNU 77-23]
ATGAAAAAACTATGGAAAAAATTACGTAAAAAATCTGTTGAAGCTTTCACACTTGTGGAGATGTTGATTGTCCTGTTAAT
CATTGGTGTCTTGATGCTTTTATTTGTACCGAATTTGAGTAAGCAAAAAGAGGCGATTCATGAAAAAGGTGATGCTGCTG
TTGTGAAAGTTGTCGAAAGTCAGAAAGAACTTTACGAAGTTAAAACAGGTAAAGAAGCAACTATTAAAGATTTGGTAAAA
GAAGGCTATATTTCACAACAACAAGCTCAAACGTATAATGAAAAAGCTAAACCTAAAGAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (13-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	68.539	89	0.61
comGC/cglC	Streptococcus mitis SK321	60.638	94	0.57
comYC	Streptococcus suis isolate S10	63.636	88	0.56
comGC/cglC	Streptococcus pneumoniae D39	59.574	94	0.56
comGC/cglC	Streptococcus pneumoniae R6	59.574	94	0.56
comGC/cglC	Streptococcus pneumoniae TIGR4	59.574	94	0.56
comGC/cglC	Streptococcus mitis NCTC 12261	59.574	94	0.56
comGC/cglC	Streptococcus pneumoniae Rx1	59.574	94	0.56
comYC	Streptococcus mutans UA140	57.303	89	0.51
comYC	Streptococcus mutans UA159	57.303	89	0.51
comGC	Lactococcus lactis subsp. cremoris KW2	50	90	0.45
comGC	Staphylococcus aureus MW2	44.186	86	0.38
comGC	Staphylococcus aureus N315	44.186	86	0.38