Detailed information NTG0406141

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GO995_RS01030
• Genome accession: NZ_CP046624
• Coordinates: 166084..166386 (+)
• Length: 100 a.a.
• NCBI ID: WP_157628643.1
• Uniprot ID: -
• Organism: Streptococcus ruminicola strain CNU_G3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 161084..171386

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GO995_RS01015 (GO995_01015)	-	163735..164103 (+)	369	WP_157628640.1	DUF1033 family protein	-
GO995_RS01020 (GO995_01020)	comYA	164176..165117 (+)	942	WP_157628641.1	competence type IV pilus ATPase ComGA	Machinery gene
GO995_RS01025 (GO995_01025)	comYB	165041..166084 (+)	1044	WP_202913541.1	competence type IV pilus assembly protein ComGB	Machinery gene
GO995_RS01030 (GO995_01030)	comYC	166084..166386 (+)	303	WP_157628643.1	competence type IV pilus major pilin ComGC	Machinery gene
GO995_RS01035 (GO995_01035)	comYD	166361..166792 (+)	432	WP_157628644.1	competence type IV pilus minor pilin ComGD	Machinery gene
GO995_RS01040 (GO995_01040)	comYE	166746..167039 (+)	294	WP_157628645.1	competence type IV pilus minor pilin ComGE	Machinery gene
GO995_RS01045 (GO995_01045)	comYF	167023..167460 (+)	438	WP_157628646.1	competence type IV pilus minor pilin ComGF	Machinery gene
GO995_RS01050 (GO995_01050)	comGG	167432..167782 (+)	351	WP_133018088.1	competence type IV pilus minor pilin ComGG	-
GO995_RS01055 (GO995_01055)	comYH	167836..168792 (+)	957	WP_006531743.1	class I SAM-dependent methyltransferase	Machinery gene
GO995_RS01060 (GO995_01060)	-	168846..170045 (+)	1200	WP_039697418.1	acetate kinase	-
GO995_RS01065 (GO995_01065)	-	170204..170401 (+)	198	WP_074561137.1	helix-turn-helix transcriptional regulator	-
GO995_RS01070 (GO995_01070)	-	170417..170617 (+)	201	WP_157628647.1	hypothetical protein	-
GO995_RS01075 (GO995_01075)	-	170618..171073 (+)	456	WP_238385877.1	ABC transporter permease	-

Sequence

Protein

• Length: 100 a.a.
• Molecular weight: 11399.57 Da
• Isoelectric Point: 10.1255

>NTDB_id=406141 GO995_RS01030 WP_157628643.1 166084..166386(+) (comYC) [Streptococcus ruminicola strain CNU_G3]
MKKIWKKLRKKSVEAFTLVEMLIVLLIIGVLMLLFVPNLSKQKDVVHEKGDAAVVKVVESQKELYEVKTGKEATIKDLVK
EGFISQEQAQTYNEAKKQNP

Nucleotide

• Length: 303 bp

>NTDB_id=406141 GO995_RS01030 WP_157628643.1 166084..166386(+) (comYC) [Streptococcus ruminicola strain CNU_G3]
ATGAAAAAAATTTGGAAAAAACTACGTAAAAAGTCTGTGGAAGCTTTCACACTTGTGGAGATGCTGATTGTTTTGCTAAT
CATTGGTGTCTTAATGCTGTTATTTGTGCCAAATTTGAGTAAGCAAAAGGATGTTGTGCATGAAAAAGGAGATGCTGCTG
TTGTCAAAGTTGTCGAAAGTCAGAAGGAACTTTACGAAGTCAAAACAGGTAAAGAAGCAACTATTAAAGATTTGGTGAAA
GAAGGATTTATTTCACAGGAACAAGCTCAAACCTACAATGAAGCTAAAAAACAAAACCCTTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (13-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	67.416	89	0.6
comGC/cglC	Streptococcus mitis NCTC 12261	59	100	0.59
comGC/cglC	Streptococcus mitis SK321	58.586	99	0.58
comYC	Streptococcus suis isolate S10	61.957	92	0.57
comGC/cglC	Streptococcus pneumoniae D39	57.576	99	0.57
comGC/cglC	Streptococcus pneumoniae R6	57.576	99	0.57
comGC/cglC	Streptococcus pneumoniae Rx1	57.576	99	0.57
comGC/cglC	Streptococcus pneumoniae TIGR4	57.576	99	0.57
comYC	Streptococcus mutans UA140	57.895	95	0.55
comYC	Streptococcus mutans UA159	57.895	95	0.55
comGC	Lactococcus lactis subsp. cremoris KW2	50.526	95	0.48
comGC	Staphylococcus aureus MW2	45.57	79	0.36
comGC	Staphylococcus aureus N315	45.57	79	0.36