Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | GOM46_RS01125 | Genome accession | NZ_CP046525 |
| Coordinates | 224195..224518 (+) | Length | 107 a.a. |
| NCBI ID | WP_235083713.1 | Uniprot ID | - |
| Organism | Streptococcus infantis strain SO | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 210915..253523 | 224195..224518 | within | 0 |
Gene organization within MGE regions
Location: 210915..253523
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GOM46_RS01060 (GOM46_01045) | - | 210915..212066 (-) | 1152 | WP_235083702.1 | tyrosine-type recombinase/integrase | - |
| GOM46_RS01065 (GOM46_01050) | - | 212118..212456 (-) | 339 | WP_235083703.1 | DUF771 domain-containing protein | - |
| GOM46_RS01070 (GOM46_01055) | - | 212521..213756 (-) | 1236 | WP_235083704.1 | replication protein RepA | - |
| GOM46_RS01075 (GOM46_01060) | - | 213905..214522 (-) | 618 | WP_235083705.1 | hypothetical protein | - |
| GOM46_RS01080 (GOM46_01065) | - | 214519..215688 (-) | 1170 | WP_235083706.1 | FtsK/SpoIIIE domain-containing protein | - |
| GOM46_RS01085 (GOM46_01070) | - | 215692..216048 (-) | 357 | WP_235083707.1 | hypothetical protein | - |
| GOM46_RS01090 (GOM46_01075) | - | 216280..216825 (+) | 546 | WP_235083708.1 | hypothetical protein | - |
| GOM46_RS01095 (GOM46_01080) | - | 216841..217179 (-) | 339 | WP_235083709.1 | helix-turn-helix domain-containing protein | - |
| GOM46_RS01100 (GOM46_01085) | - | 217344..219962 (+) | 2619 | WP_235083710.1 | SEC10/PgrA surface exclusion domain-containing protein | - |
| GOM46_RS01105 (GOM46_01090) | nagA | 220543..221694 (+) | 1152 | WP_006150219.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| GOM46_RS01110 (GOM46_01095) | - | 221860..222237 (+) | 378 | WP_006150119.1 | DUF1033 family protein | - |
| GOM46_RS01115 (GOM46_01100) | comGA/cglA/cilD | 222289..223227 (+) | 939 | WP_235083711.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| GOM46_RS01120 (GOM46_01105) | comGB/cglB | 223151..224194 (+) | 1044 | WP_235083712.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| GOM46_RS01125 (GOM46_01110) | comGC/cglC | 224195..224518 (+) | 324 | WP_235083713.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| GOM46_RS01130 (GOM46_01115) | comGD/cglD | 224481..224915 (+) | 435 | WP_029689590.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| GOM46_RS01135 (GOM46_01120) | comGE/cglE | 224878..225180 (+) | 303 | WP_025169999.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| GOM46_RS01140 (GOM46_01125) | comGF/cglF | 225143..225604 (+) | 462 | WP_235083714.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| GOM46_RS01145 (GOM46_01130) | comGG | 225582..226019 (+) | 438 | WP_235083715.1 | competence type IV pilus minor pilin ComGG | - |
| GOM46_RS01150 (GOM46_01135) | - | 226078..226779 (+) | 702 | WP_235083716.1 | histidine phosphatase family protein | - |
| GOM46_RS01155 (GOM46_01140) | - | 226971..228677 (+) | 1707 | WP_235083717.1 | ABC transporter ATP-binding protein | - |
| GOM46_RS01160 (GOM46_01145) | - | 228679..230445 (+) | 1767 | WP_235083718.1 | ABC transporter ATP-binding protein | - |
| GOM46_RS01165 (GOM46_01150) | - | 230583..231272 (+) | 690 | WP_070889112.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| GOM46_RS01170 (GOM46_01155) | - | 231444..232793 (+) | 1350 | WP_000018239.1 | glucose-6-phosphate isomerase | - |
| GOM46_RS01175 (GOM46_01160) | - | 232977..233777 (+) | 801 | WP_001000837.1 | SDR family oxidoreductase | - |
| GOM46_RS01180 (GOM46_01165) | - | 233840..235666 (+) | 1827 | WP_080981318.1 | BglG family transcription antiterminator | - |
| GOM46_RS01185 (GOM46_01170) | - | 235666..236163 (+) | 498 | WP_001086645.1 | transcriptional regulator GutM | - |
| GOM46_RS01190 (GOM46_01175) | - | 236160..236705 (+) | 546 | WP_001015684.1 | PTS glucitol/sorbitol transporter subunit IIC | - |
| GOM46_RS01195 (GOM46_01180) | - | 236719..237699 (+) | 981 | WP_000120696.1 | PTS glucitol/sorbitol transporter subunit IIB | - |
| GOM46_RS01200 (GOM46_01185) | - | 237797..238168 (+) | 372 | WP_033585537.1 | PTS glucitol/sorbitol transporter subunit IIA | - |
| GOM46_RS01205 (GOM46_01190) | pgi | 238365..238841 (+) | 477 | Protein_214 | glucose-6-phosphate isomerase | - |
| GOM46_RS01210 (GOM46_01195) | gltX | 238973..240433 (+) | 1461 | WP_235083719.1 | glutamate--tRNA ligase | - |
| GOM46_RS01215 (GOM46_01200) | - | 240908..242122 (+) | 1215 | WP_235083720.1 | pyridoxal phosphate-dependent aminotransferase | - |
| GOM46_RS01220 (GOM46_01205) | rpmH | 242267..242401 (+) | 135 | WP_000831905.1 | 50S ribosomal protein L34 | - |
| GOM46_RS01225 (GOM46_01210) | - | 242581..244425 (-) | 1845 | WP_235083721.1 | APC family permease | - |
| GOM46_RS01230 (GOM46_01215) | - | 244582..245358 (+) | 777 | WP_235083722.1 | TatD family hydrolase | - |
| GOM46_RS01235 (GOM46_01220) | rnmV | 245355..245918 (+) | 564 | WP_235083723.1 | ribonuclease M5 | - |
| GOM46_RS01240 (GOM46_01225) | - | 246052..247470 (+) | 1419 | WP_235083724.1 | SseB family protein | - |
| GOM46_RS01245 (GOM46_01230) | - | 247561..248277 (+) | 717 | WP_235084135.1 | dimethyladenosine transferase | - |
| GOM46_RS01250 (GOM46_01235) | rsmA | 248290..249162 (+) | 873 | WP_235083725.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| GOM46_RS01255 (GOM46_01240) | rsgA | 249164..250042 (+) | 879 | WP_235083726.1 | ribosome small subunit-dependent GTPase A | - |
| GOM46_RS01260 (GOM46_01245) | rpe | 250053..250709 (+) | 657 | WP_235083727.1 | ribulose-phosphate 3-epimerase | - |
| GOM46_RS01265 (GOM46_01250) | - | 250672..251334 (+) | 663 | WP_235083728.1 | thiamine diphosphokinase | - |
| GOM46_RS01270 (GOM46_01255) | rmuC | 251336..252592 (+) | 1257 | WP_235083729.1 | DNA recombination protein RmuC | - |
| GOM46_RS01275 (GOM46_01260) | - | 252582..253523 (+) | 942 | WP_045614706.1 | 3'-5' exoribonuclease YhaM family protein | - |
Sequence
Protein
Download Length: 107 a.a. Molecular weight: 11926.15 Da Isoelectric Point: 10.0527
>NTDB_id=405038 GOM46_RS01125 WP_235083713.1 224195..224518(+) (comGC/cglC) [Streptococcus infantis strain SO]
MKKMMMKLKEAKVKAFTLIEMLVVLLIISVLLLLFVPNLTKQKDAVNDKGKAAVVKVVESQAELYSLDKNEDASLSKLQA
DGRITAEQAKAYKEYHAKQKTSQTVAD
MKKMMMKLKEAKVKAFTLIEMLVVLLIISVLLLLFVPNLTKQKDAVNDKGKAAVVKVVESQAELYSLDKNEDASLSKLQA
DGRITAEQAKAYKEYHAKQKTSQTVAD
Nucleotide
Download Length: 324 bp
>NTDB_id=405038 GOM46_RS01125 WP_235083713.1 224195..224518(+) (comGC/cglC) [Streptococcus infantis strain SO]
ATGAAAAAAATGATGATGAAATTAAAAGAAGCAAAGGTAAAAGCTTTTACTCTGATCGAAATGTTAGTGGTTCTTCTTAT
CATTAGCGTCCTACTCTTGCTTTTTGTGCCAAATCTGACGAAGCAAAAGGATGCAGTGAATGACAAGGGGAAAGCGGCTG
TCGTCAAGGTGGTAGAAAGTCAGGCAGAACTCTATAGTCTGGACAAAAATGAAGATGCCAGTCTAAGCAAATTACAGGCA
GATGGACGTATCACTGCCGAGCAGGCAAAAGCCTATAAAGAATATCATGCAAAGCAAAAGACAAGTCAAACAGTTGCGGA
TTAG
ATGAAAAAAATGATGATGAAATTAAAAGAAGCAAAGGTAAAAGCTTTTACTCTGATCGAAATGTTAGTGGTTCTTCTTAT
CATTAGCGTCCTACTCTTGCTTTTTGTGCCAAATCTGACGAAGCAAAAGGATGCAGTGAATGACAAGGGGAAAGCGGCTG
TCGTCAAGGTGGTAGAAAGTCAGGCAGAACTCTATAGTCTGGACAAAAATGAAGATGCCAGTCTAAGCAAATTACAGGCA
GATGGACGTATCACTGCCGAGCAGGCAAAAGCCTATAAAGAATATCATGCAAAGCAAAAGACAAGTCAAACAGTTGCGGA
TTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus mitis NCTC 12261 |
93.458 |
100 |
0.935 |
| comGC/cglC | Streptococcus mitis SK321 |
90.909 |
92.523 |
0.841 |
| comGC/cglC | Streptococcus pneumoniae D39 |
88.889 |
92.523 |
0.822 |
| comGC/cglC | Streptococcus pneumoniae R6 |
88.889 |
92.523 |
0.822 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
88.889 |
92.523 |
0.822 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
87.879 |
92.523 |
0.813 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
66.667 |
98.131 |
0.654 |
| comYC | Streptococcus mutans UA140 |
70.103 |
90.654 |
0.636 |
| comYC | Streptococcus mutans UA159 |
70.103 |
90.654 |
0.636 |
| comYC | Streptococcus suis isolate S10 |
68.182 |
82.243 |
0.561 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
56.863 |
95.327 |
0.542 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
44.444 |
84.112 |
0.374 |
| comGC | Staphylococcus aureus MW2 |
52.703 |
69.159 |
0.364 |
| comGC | Staphylococcus aureus N315 |
52.703 |
69.159 |
0.364 |