Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DXY21_RS09335 Genome accession   NZ_CP031694
Coordinates   1834397..1834537 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM101368     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1829397..1839537
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXY21_RS09310 (DXY21_01855) - 1829703..1830101 (+) 399 WP_003152031.1 YueI family protein -
  DXY21_RS09315 (DXY21_01856) - 1830198..1830749 (+) 552 WP_025853916.1 cysteine hydrolase family protein -
  DXY21_RS09320 (DXY21_01857) - 1830767..1832233 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  DXY21_RS09325 (DXY21_01858) - 1832363..1833583 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  DXY21_RS09330 (DXY21_01859) - 1833590..1833931 (-) 342 WP_014305721.1 hypothetical protein -
  DXY21_RS09335 (DXY21_01861) degQ 1834397..1834537 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DXY21_RS09340 (DXY21_01862) comQ 1834722..1835654 (+) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  DXY21_RS09350 (DXY21_01864) comP 1835807..1838110 (+) 2304 WP_069473559.1 histidine kinase Regulator
  DXY21_RS09355 (DXY21_01865) comA 1838191..1838835 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  DXY21_RS09360 (DXY21_01866) - 1838857..1839240 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=310393 DXY21_RS09335 WP_003152043.1 1834397..1834537(+) (degQ) [Bacillus velezensis strain SRCM101368]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=310393 DXY21_RS09335 WP_003152043.1 1834397..1834537(+) (degQ) [Bacillus velezensis strain SRCM101368]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment