Detailed information NTG1147512

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: CKV85_RS10455
• Genome accession: NZ_LT906454
• Coordinates: 2123929..2124219 (-)
• Length: 96 a.a.
• NCBI ID: WP_095123578.1
• Uniprot ID: -
• Organism: Streptococcus acidominimus strain NCTC11291
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2118929..2129219

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CKV85_RS10415 (SAMEA4504048_02225)	-	2119613..2119810 (-)	198	WP_017770225.1	helix-turn-helix transcriptional regulator	-
CKV85_RS10425 (SAMEA4504048_02227)	-	2120200..2121390 (-)	1191	WP_017770223.1	acetate kinase	-
CKV85_RS10430 (SAMEA4504048_02228)	comYH	2121451..2122404 (-)	954	WP_095123575.1	class I SAM-dependent methyltransferase	Machinery gene
CKV85_RS10435 (SAMEA4504048_02229)	comGG	2122476..2122865 (-)	390	WP_197697097.1	competence type IV pilus minor pilin ComGG	-
CKV85_RS10440 (SAMEA4504048_02230)	comYF	2122843..2123280 (-)	438	WP_017770220.1	competence type IV pilus minor pilin ComGF	Machinery gene
CKV85_RS10445	comGE	2123258..2123503 (-)	246	WP_231909805.1	competence system putative prepilin ComGE	-
CKV85_RS10450 (SAMEA4504048_02231)	comGD	2123529..2123945 (-)	417	WP_095123577.1	competence type IV pilus minor pilin ComGD	-
CKV85_RS10455 (SAMEA4504048_02232)	comYC	2123929..2124219 (-)	291	WP_095123578.1	competence type IV pilus major pilin ComGC	Machinery gene
CKV85_RS10460 (SAMEA4504048_02233)	comYB	2124220..2125170 (-)	951	WP_269457190.1	competence type IV pilus assembly protein ComGB	Machinery gene
CKV85_RS10465 (SAMEA4504048_02234)	comYA	2125172..2126125 (-)	954	WP_017770215.1	competence type IV pilus ATPase ComGA	Machinery gene
CKV85_RS10470 (SAMEA4504048_02235)	-	2126245..2126625 (-)	381	WP_017770214.1	DUF1033 family protein	-

Sequence

Protein

• Length: 96 a.a.
• Molecular weight: 10933.00 Da
• Isoelectric Point: 10.0501

>NTDB_id=1147512 CKV85_RS10455 WP_095123578.1 2123929..2124219(-) (comYC) [Streptococcus acidominimus strain NCTC11291]
MKENYRKMKKKTVKAFTLVEMLIVLLIISVLMLLFVPNLSKQKAAVDEKGKAAVVKVVESQMELYEMNHDTKPNLNQLVS
EGYITQKQADTYAKAN

Nucleotide

• Length: 291 bp

>NTDB_id=1147512 CKV85_RS10455 WP_095123578.1 2123929..2124219(-) (comYC) [Streptococcus acidominimus strain NCTC11291]
ATGAAAGAAAATTATAGAAAAATGAAGAAAAAAACTGTGAAAGCTTTCACTCTTGTGGAGATGCTTATAGTTTTACTTAT
CATCAGTGTTTTGATGCTCTTGTTTGTGCCTAATTTGAGCAAGCAAAAGGCTGCTGTAGATGAAAAAGGAAAGGCAGCAG
TGGTTAAAGTGGTAGAAAGTCAGATGGAGCTCTACGAAATGAATCACGACACTAAGCCAAACCTCAATCAGTTGGTTTCA
GAAGGGTACATTACGCAAAAACAAGCAGACACTTATGCCAAAGCTAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (12-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	70.115	90.625	0.635
comGC	Lactococcus lactis subsp. cremoris KW2	65.909	91.667	0.604
comGC/cglC	Streptococcus pneumoniae TIGR4	64.045	92.708	0.594
comYC	Streptococcus suis isolate S10	63.333	93.75	0.594
comGC/cglC	Streptococcus mitis SK321	65.882	88.542	0.583
comGC/cglC	Streptococcus mitis NCTC 12261	65.882	88.542	0.583
comGC/cglC	Streptococcus pneumoniae Rx1	65.882	88.542	0.583
comGC/cglC	Streptococcus pneumoniae D39	65.882	88.542	0.583
comGC/cglC	Streptococcus pneumoniae R6	65.882	88.542	0.583
comYC	Streptococcus mutans UA140	60.92	90.625	0.552
comYC	Streptococcus mutans UA159	60.92	90.625	0.552
comGC	Staphylococcus aureus MW2	45.57	82.292	0.375
comGC	Staphylococcus aureus N315	45.57	82.292	0.375
comGC	Latilactobacillus sakei subsp. sakei 23K	43.21	84.375	0.365