Detailed information
Bioinformatically predicted
Overview
| Name | pilE | Type | Machinery gene |
| Locus tag | ABEF85_RS13445 | Genome accession | NZ_CP156776 |
| Coordinates | 2755374..2755778 (+) | Length | 134 a.a. |
| NCBI ID | WP_404798888.1 | Uniprot ID | - |
| Organism | Acinetobacter thermotolerans strain ANC 7955 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 2718550..2771288 | 2755374..2755778 | within | 0 |
| IS/Tn | 2754192..2755154 | 2755374..2755778 | flank | 220 |
Gene organization within MGE regions
Location: 2718550..2771288
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABEF85_RS13250 (ABEF85_13250) | - | 2718550..2718924 (-) | 375 | WP_347453528.1 | hypothetical protein | - |
| ABEF85_RS13255 (ABEF85_13255) | - | 2719075..2720484 (-) | 1410 | WP_347454120.1 | FAD-binding oxidoreductase | - |
| ABEF85_RS13260 (ABEF85_13260) | serA | 2720839..2722071 (+) | 1233 | WP_034587753.1 | phosphoglycerate dehydrogenase | - |
| ABEF85_RS13265 (ABEF85_13265) | - | 2722251..2723069 (+) | 819 | Protein_2562 | EamA family transporter | - |
| ABEF85_RS13270 (ABEF85_13270) | - | 2723074..2723391 (-) | 318 | WP_347454461.1 | hypothetical protein | - |
| ABEF85_RS13275 (ABEF85_13275) | tnpA | 2723546..2723959 (-) | 414 | WP_347453461.1 | IS200/IS605 family transposase | - |
| ABEF85_RS13280 (ABEF85_13280) | - | 2723980..2725038 (+) | 1059 | WP_034586922.1 | RNA-guided endonuclease TnpB family protein | - |
| ABEF85_RS13285 (ABEF85_13285) | - | 2725254..2725427 (-) | 174 | WP_347454463.1 | hypothetical protein | - |
| ABEF85_RS13290 (ABEF85_13290) | - | 2725550..2726701 (-) | 1152 | WP_347456737.1 | hypothetical protein | - |
| ABEF85_RS13295 (ABEF85_13295) | - | 2726946..2727823 (+) | 878 | Protein_2568 | IS982-like element ISAba825 family transposase | - |
| ABEF85_RS13300 (ABEF85_13300) | - | 2728007..2728885 (+) | 879 | WP_347453527.1 | EamA family transporter | - |
| ABEF85_RS13305 (ABEF85_13305) | - | 2728957..2729370 (+) | 414 | WP_347455493.1 | hypothetical protein | - |
| ABEF85_RS13310 (ABEF85_13310) | - | 2729425..2729892 (-) | 468 | WP_347453525.1 | hemerythrin domain-containing protein | - |
| ABEF85_RS13315 (ABEF85_13315) | - | 2730021..2730788 (-) | 768 | WP_347455492.1 | TSUP family transporter | - |
| ABEF85_RS13320 (ABEF85_13320) | truB | 2730811..2731716 (-) | 906 | WP_347453523.1 | tRNA pseudouridine(55) synthase TruB | - |
| ABEF85_RS13325 (ABEF85_13325) | - | 2731872..2732903 (+) | 1032 | WP_347455491.1 | lipase secretion chaperone | - |
| ABEF85_RS13330 (ABEF85_13330) | - | 2733439..2734422 (+) | 984 | WP_034587797.1 | triacylglycerol lipase | - |
| ABEF85_RS13335 (ABEF85_13335) | rplS | 2734484..2734855 (-) | 372 | WP_004787066.1 | 50S ribosomal protein L19 | - |
| ABEF85_RS13340 (ABEF85_13340) | trmD | 2735031..2735780 (-) | 750 | WP_347456186.1 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
| ABEF85_RS13345 (ABEF85_13345) | rimM | 2735822..2736370 (-) | 549 | WP_034587737.1 | ribosome maturation factor RimM | - |
| ABEF85_RS13350 (ABEF85_13350) | rpsP | 2736400..2736657 (-) | 258 | WP_034587736.1 | 30S ribosomal protein S16 | - |
| ABEF85_RS13355 (ABEF85_13355) | - | 2736783..2737277 (-) | 495 | WP_347453519.1 | type IV pilin protein | - |
| ABEF85_RS13360 (ABEF85_13360) | comE | 2737271..2737717 (-) | 447 | WP_347453518.1 | type IV pilin protein | Machinery gene |
| ABEF85_RS13365 (ABEF85_13365) | - | 2737728..2741513 (-) | 3786 | WP_347453517.1 | pilus assembly protein PilY | - |
| ABEF85_RS13370 (ABEF85_13370) | - | 2741529..2742296 (-) | 768 | WP_347453516.1 | pilus assembly protein PilX | - |
| ABEF85_RS13375 (ABEF85_13375) | - | 2742293..2743315 (-) | 1023 | WP_347453515.1 | PilW family protein | - |
| ABEF85_RS13380 (ABEF85_13380) | pilV | 2743317..2743826 (-) | 510 | WP_180016635.1 | type IV pilus modification protein PilV | - |
| ABEF85_RS13385 (ABEF85_13385) | - | 2743826..2744272 (-) | 447 | WP_347453514.1 | GspH/FimT family pseudopilin | - |
| ABEF85_RS13390 (ABEF85_13390) | ispH | 2744437..2745387 (-) | 951 | WP_347453513.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| ABEF85_RS13395 (ABEF85_13395) | gmk | 2745522..2746145 (+) | 624 | WP_347453512.1 | guanylate kinase | - |
| ABEF85_RS13400 (ABEF85_13400) | rpoZ | 2746220..2746501 (+) | 282 | WP_034587719.1 | DNA-directed RNA polymerase subunit omega | - |
| ABEF85_RS13405 (ABEF85_13405) | - | 2746713..2748815 (+) | 2103 | WP_347463918.1 | HD domain-containing protein | - |
| ABEF85_RS13410 (ABEF85_13410) | - | 2748891..2749274 (+) | 384 | WP_347454481.1 | RidA family protein | - |
| ABEF85_RS13415 (ABEF85_13415) | - | 2749463..2749657 (+) | 195 | WP_347453509.1 | bacterioferritin-associated ferredoxin | - |
| ABEF85_RS13420 (ABEF85_13420) | bfr | 2749897..2750361 (+) | 465 | WP_347463920.1 | bacterioferritin | - |
| ABEF85_RS13425 (ABEF85_13425) | - | 2750428..2752065 (-) | 1638 | WP_347463922.1 | Wzy polymerase domain-containing protein | - |
| ABEF85_RS13430 (ABEF85_13430) | tfpZ | 2752153..2752887 (-) | 735 | WP_347463924.1 | TfpX/TfpZ family type IV pilin accessory protein | - |
| ABEF85_RS13435 (ABEF85_13435) | - | 2753017..2753526 (-) | 510 | WP_347463926.1 | pilin | - |
| ABEF85_RS13440 (ABEF85_13440) | - | 2754192..2755154 (+) | 963 | WP_075174500.1 | IS30-like element IS18 family transposase | - |
| ABEF85_RS13445 (ABEF85_13445) | pilE | 2755374..2755778 (+) | 405 | WP_404798888.1 | pilin | Machinery gene |
| ABEF85_RS13450 (ABEF85_13450) | - | 2755840..2757804 (+) | 1965 | WP_347463930.1 | hypothetical protein | - |
| ABEF85_RS13455 (ABEF85_13455) | - | 2757794..2758645 (+) | 852 | WP_347463932.1 | glycosyltransferase family 2 protein | - |
| ABEF85_RS13460 (ABEF85_13460) | - | 2758700..2759872 (+) | 1173 | WP_347463934.1 | oligosaccharide flippase family protein | - |
| ABEF85_RS13465 (ABEF85_13465) | - | 2759824..2760588 (+) | 765 | WP_291340458.1 | FkbM family methyltransferase | - |
| ABEF85_RS13470 (ABEF85_13470) | - | 2760592..2761356 (-) | 765 | WP_347463936.1 | glycosyltransferase family 25 protein | - |
| ABEF85_RS13475 (ABEF85_13475) | wecB | 2761368..2762462 (-) | 1095 | WP_347463938.1 | non-hydrolyzing UDP-N-acetylglucosamine 2-epimerase | - |
| ABEF85_RS13480 (ABEF85_13480) | - | 2762446..2763543 (-) | 1098 | WP_291340461.1 | glycosyltransferase | - |
| ABEF85_RS13485 (ABEF85_13485) | - | 2763540..2763860 (-) | 321 | WP_347463940.1 | glycosyltransferase | - |
| ABEF85_RS13490 (ABEF85_13490) | - | 2763885..2764946 (-) | 1062 | WP_243474114.1 | UDP-N-acetylglucosamine 2-epimerase | - |
| ABEF85_RS13495 (ABEF85_13495) | - | 2765310..2766242 (+) | 933 | WP_347463943.1 | IS5-like element IS17 family transposase | - |
| ABEF85_RS13500 (ABEF85_13500) | - | 2766290..2766823 (-) | 534 | Protein_2609 | IS5-like element ISAba10 family transposase | - |
| ABEF85_RS13505 (ABEF85_13505) | - | 2767162..2767674 (-) | 513 | WP_005156556.1 | hypothetical protein | - |
| ABEF85_RS13510 (ABEF85_13510) | - | 2767981..2768541 (-) | 561 | WP_347463945.1 | TPM domain-containing protein | - |
| ABEF85_RS13515 (ABEF85_13515) | - | 2768535..2769590 (-) | 1056 | WP_347464317.1 | TPM domain-containing protein | - |
| ABEF85_RS13520 (ABEF85_13520) | - | 2769625..2770215 (-) | 591 | WP_347464319.1 | LemA family protein | - |
| ABEF85_RS13525 (ABEF85_13525) | - | 2770326..2771288 (-) | 963 | WP_347455249.1 | IS30-like element IS18 family transposase | - |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 14028.78 Da Isoelectric Point: 5.0032
>NTDB_id=1002643 ABEF85_RS13445 WP_404798888.1 2755374..2755778(+) (pilE) [Acinetobacter thermotolerans strain ANC 7955]
MQKGFTLIELMIVVAIIGILAAIAIPAYQNYTKRSHVSEGLSLASGAKAAVTEYYSSNGEWPTDNTEAGISTTISGNAVT
SVEINASLITVTYNTKVTSGAKLTLQGSDSNGSVNWTCAAGSNMDEKFVPSNCR
MQKGFTLIELMIVVAIIGILAAIAIPAYQNYTKRSHVSEGLSLASGAKAAVTEYYSSNGEWPTDNTEAGISTTISGNAVT
SVEINASLITVTYNTKVTSGAKLTLQGSDSNGSVNWTCAAGSNMDEKFVPSNCR
Nucleotide
Download Length: 405 bp
>NTDB_id=1002643 ABEF85_RS13445 WP_404798888.1 2755374..2755778(+) (pilE) [Acinetobacter thermotolerans strain ANC 7955]
ATGCAGAAGGGCTTCACGCTCATCGAACTCATGATTGTAGTCGCAATTATTGGTATTTTGGCTGCAATTGCGATTCCTGC
TTATCAAAACTACACGAAGCGTTCTCACGTTTCTGAAGGTTTAAGCCTTGCTAGTGGTGCTAAAGCAGCTGTAACTGAAT
ATTATTCGTCTAATGGAGAATGGCCGACAGACAATACCGAAGCTGGTATTTCAACAACAATTTCTGGCAATGCGGTAACA
TCTGTTGAAATTAATGCATCGTTAATTACAGTTACATACAATACAAAAGTAACATCAGGTGCAAAGTTAACATTACAAGG
TTCTGATTCCAATGGTTCTGTTAACTGGACATGTGCTGCTGGTTCAAATATGGACGAAAAATTCGTACCATCTAACTGCC
GTTAA
ATGCAGAAGGGCTTCACGCTCATCGAACTCATGATTGTAGTCGCAATTATTGGTATTTTGGCTGCAATTGCGATTCCTGC
TTATCAAAACTACACGAAGCGTTCTCACGTTTCTGAAGGTTTAAGCCTTGCTAGTGGTGCTAAAGCAGCTGTAACTGAAT
ATTATTCGTCTAATGGAGAATGGCCGACAGACAATACCGAAGCTGGTATTTCAACAACAATTTCTGGCAATGCGGTAACA
TCTGTTGAAATTAATGCATCGTTAATTACAGTTACATACAATACAAAAGTAACATCAGGTGCAAAGTTAACATTACAAGG
TTCTGATTCCAATGGTTCTGTTAACTGGACATGTGCTGCTGGTTCAAATATGGACGAAAAATTCGTACCATCTAACTGCC
GTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilE | Neisseria gonorrhoeae MS11 |
47.134 |
100 |
0.552 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
45.806 |
100 |
0.53 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
41.071 |
100 |
0.515 |
| comP | Acinetobacter baylyi ADP1 |
46.207 |
100 |
0.5 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
48.507 |
100 |
0.485 |
| pilA2 | Legionella pneumophila str. Paris |
48.507 |
100 |
0.485 |
| pilA | Vibrio cholerae C6706 |
39.86 |
100 |
0.425 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
39.86 |
100 |
0.425 |
| pilA | Vibrio cholerae strain A1552 |
39.86 |
100 |
0.425 |
| pilA | Acinetobacter baumannii strain A118 |
41.007 |
100 |
0.425 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
39.161 |
100 |
0.418 |
| pilA | Pseudomonas aeruginosa PAK |
37.584 |
100 |
0.418 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40 |
100 |
0.418 |
| pilA | Haemophilus influenzae Rd KW20 |
39.259 |
100 |
0.396 |