Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE   Type   Machinery gene
Locus tag   ABEF85_RS13360 Genome accession   NZ_CP156776
Coordinates   2737271..2737717 (-) Length   148 a.a.
NCBI ID   WP_347453518.1    Uniprot ID   -
Organism   Acinetobacter thermotolerans strain ANC 7955     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2718550..2771288 2737271..2737717 within 0


Gene organization within MGE regions


Location: 2718550..2771288
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABEF85_RS13250 (ABEF85_13250) - 2718550..2718924 (-) 375 WP_347453528.1 hypothetical protein -
  ABEF85_RS13255 (ABEF85_13255) - 2719075..2720484 (-) 1410 WP_347454120.1 FAD-binding oxidoreductase -
  ABEF85_RS13260 (ABEF85_13260) serA 2720839..2722071 (+) 1233 WP_034587753.1 phosphoglycerate dehydrogenase -
  ABEF85_RS13265 (ABEF85_13265) - 2722251..2723069 (+) 819 Protein_2562 EamA family transporter -
  ABEF85_RS13270 (ABEF85_13270) - 2723074..2723391 (-) 318 WP_347454461.1 hypothetical protein -
  ABEF85_RS13275 (ABEF85_13275) tnpA 2723546..2723959 (-) 414 WP_347453461.1 IS200/IS605 family transposase -
  ABEF85_RS13280 (ABEF85_13280) - 2723980..2725038 (+) 1059 WP_034586922.1 RNA-guided endonuclease TnpB family protein -
  ABEF85_RS13285 (ABEF85_13285) - 2725254..2725427 (-) 174 WP_347454463.1 hypothetical protein -
  ABEF85_RS13290 (ABEF85_13290) - 2725550..2726701 (-) 1152 WP_347456737.1 hypothetical protein -
  ABEF85_RS13295 (ABEF85_13295) - 2726946..2727823 (+) 878 Protein_2568 IS982-like element ISAba825 family transposase -
  ABEF85_RS13300 (ABEF85_13300) - 2728007..2728885 (+) 879 WP_347453527.1 EamA family transporter -
  ABEF85_RS13305 (ABEF85_13305) - 2728957..2729370 (+) 414 WP_347455493.1 hypothetical protein -
  ABEF85_RS13310 (ABEF85_13310) - 2729425..2729892 (-) 468 WP_347453525.1 hemerythrin domain-containing protein -
  ABEF85_RS13315 (ABEF85_13315) - 2730021..2730788 (-) 768 WP_347455492.1 TSUP family transporter -
  ABEF85_RS13320 (ABEF85_13320) truB 2730811..2731716 (-) 906 WP_347453523.1 tRNA pseudouridine(55) synthase TruB -
  ABEF85_RS13325 (ABEF85_13325) - 2731872..2732903 (+) 1032 WP_347455491.1 lipase secretion chaperone -
  ABEF85_RS13330 (ABEF85_13330) - 2733439..2734422 (+) 984 WP_034587797.1 triacylglycerol lipase -
  ABEF85_RS13335 (ABEF85_13335) rplS 2734484..2734855 (-) 372 WP_004787066.1 50S ribosomal protein L19 -
  ABEF85_RS13340 (ABEF85_13340) trmD 2735031..2735780 (-) 750 WP_347456186.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  ABEF85_RS13345 (ABEF85_13345) rimM 2735822..2736370 (-) 549 WP_034587737.1 ribosome maturation factor RimM -
  ABEF85_RS13350 (ABEF85_13350) rpsP 2736400..2736657 (-) 258 WP_034587736.1 30S ribosomal protein S16 -
  ABEF85_RS13355 (ABEF85_13355) - 2736783..2737277 (-) 495 WP_347453519.1 type IV pilin protein -
  ABEF85_RS13360 (ABEF85_13360) comE 2737271..2737717 (-) 447 WP_347453518.1 type IV pilin protein Machinery gene
  ABEF85_RS13365 (ABEF85_13365) - 2737728..2741513 (-) 3786 WP_347453517.1 pilus assembly protein PilY -
  ABEF85_RS13370 (ABEF85_13370) - 2741529..2742296 (-) 768 WP_347453516.1 pilus assembly protein PilX -
  ABEF85_RS13375 (ABEF85_13375) - 2742293..2743315 (-) 1023 WP_347453515.1 PilW family protein -
  ABEF85_RS13380 (ABEF85_13380) pilV 2743317..2743826 (-) 510 WP_180016635.1 type IV pilus modification protein PilV -
  ABEF85_RS13385 (ABEF85_13385) - 2743826..2744272 (-) 447 WP_347453514.1 GspH/FimT family pseudopilin -
  ABEF85_RS13390 (ABEF85_13390) ispH 2744437..2745387 (-) 951 WP_347453513.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  ABEF85_RS13395 (ABEF85_13395) gmk 2745522..2746145 (+) 624 WP_347453512.1 guanylate kinase -
  ABEF85_RS13400 (ABEF85_13400) rpoZ 2746220..2746501 (+) 282 WP_034587719.1 DNA-directed RNA polymerase subunit omega -
  ABEF85_RS13405 (ABEF85_13405) - 2746713..2748815 (+) 2103 WP_347463918.1 HD domain-containing protein -
  ABEF85_RS13410 (ABEF85_13410) - 2748891..2749274 (+) 384 WP_347454481.1 RidA family protein -
  ABEF85_RS13415 (ABEF85_13415) - 2749463..2749657 (+) 195 WP_347453509.1 bacterioferritin-associated ferredoxin -
  ABEF85_RS13420 (ABEF85_13420) bfr 2749897..2750361 (+) 465 WP_347463920.1 bacterioferritin -
  ABEF85_RS13425 (ABEF85_13425) - 2750428..2752065 (-) 1638 WP_347463922.1 Wzy polymerase domain-containing protein -
  ABEF85_RS13430 (ABEF85_13430) tfpZ 2752153..2752887 (-) 735 WP_347463924.1 TfpX/TfpZ family type IV pilin accessory protein -
  ABEF85_RS13435 (ABEF85_13435) - 2753017..2753526 (-) 510 WP_347463926.1 pilin -
  ABEF85_RS13440 (ABEF85_13440) - 2754192..2755154 (+) 963 WP_075174500.1 IS30-like element IS18 family transposase -
  ABEF85_RS13445 (ABEF85_13445) pilE 2755374..2755778 (+) 405 WP_404798888.1 pilin Machinery gene
  ABEF85_RS13450 (ABEF85_13450) - 2755840..2757804 (+) 1965 WP_347463930.1 hypothetical protein -
  ABEF85_RS13455 (ABEF85_13455) - 2757794..2758645 (+) 852 WP_347463932.1 glycosyltransferase family 2 protein -
  ABEF85_RS13460 (ABEF85_13460) - 2758700..2759872 (+) 1173 WP_347463934.1 oligosaccharide flippase family protein -
  ABEF85_RS13465 (ABEF85_13465) - 2759824..2760588 (+) 765 WP_291340458.1 FkbM family methyltransferase -
  ABEF85_RS13470 (ABEF85_13470) - 2760592..2761356 (-) 765 WP_347463936.1 glycosyltransferase family 25 protein -
  ABEF85_RS13475 (ABEF85_13475) wecB 2761368..2762462 (-) 1095 WP_347463938.1 non-hydrolyzing UDP-N-acetylglucosamine 2-epimerase -
  ABEF85_RS13480 (ABEF85_13480) - 2762446..2763543 (-) 1098 WP_291340461.1 glycosyltransferase -
  ABEF85_RS13485 (ABEF85_13485) - 2763540..2763860 (-) 321 WP_347463940.1 glycosyltransferase -
  ABEF85_RS13490 (ABEF85_13490) - 2763885..2764946 (-) 1062 WP_243474114.1 UDP-N-acetylglucosamine 2-epimerase -
  ABEF85_RS13495 (ABEF85_13495) - 2765310..2766242 (+) 933 WP_347463943.1 IS5-like element IS17 family transposase -
  ABEF85_RS13500 (ABEF85_13500) - 2766290..2766823 (-) 534 Protein_2609 IS5-like element ISAba10 family transposase -
  ABEF85_RS13505 (ABEF85_13505) - 2767162..2767674 (-) 513 WP_005156556.1 hypothetical protein -
  ABEF85_RS13510 (ABEF85_13510) - 2767981..2768541 (-) 561 WP_347463945.1 TPM domain-containing protein -
  ABEF85_RS13515 (ABEF85_13515) - 2768535..2769590 (-) 1056 WP_347464317.1 TPM domain-containing protein -
  ABEF85_RS13520 (ABEF85_13520) - 2769625..2770215 (-) 591 WP_347464319.1 LemA family protein -
  ABEF85_RS13525 (ABEF85_13525) - 2770326..2771288 (-) 963 WP_347455249.1 IS30-like element IS18 family transposase -

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 16269.61 Da        Isoelectric Point: 8.4895

>NTDB_id=1002642 ABEF85_RS13360 WP_347453518.1 2737271..2737717(-) (comE) [Acinetobacter thermotolerans strain ANC 7955]
MNLNISPTKGFTLIELMVVVVIVAIFAAIAIPSYQSMVRRGQAAQAQDQLQQIAMALDKHKSRNFSYEGFSIPTDLTVLP
KGATGSAIRYNFNLVAGSTGQTWVLTAESKDTRNYSFLMSSTGLRCKNTTWNNIDTMNLTCGAGHEEW

Nucleotide


Download         Length: 447 bp        

>NTDB_id=1002642 ABEF85_RS13360 WP_347453518.1 2737271..2737717(-) (comE) [Acinetobacter thermotolerans strain ANC 7955]
ATGAATTTAAATATTTCACCGACCAAGGGCTTCACTTTAATTGAACTGATGGTGGTGGTGGTAATTGTTGCGATTTTCGC
AGCAATTGCCATTCCATCCTATCAGTCAATGGTTCGACGTGGTCAGGCAGCACAGGCTCAAGATCAGTTACAGCAAATTG
CCATGGCACTTGATAAGCATAAATCACGTAATTTTAGCTATGAAGGTTTTAGTATACCCACGGACTTAACCGTGCTTCCT
AAAGGGGCAACTGGATCTGCAATCAGATATAATTTTAATTTGGTTGCGGGATCAACAGGGCAAACTTGGGTATTAACCGC
TGAAAGTAAAGATACGAGGAACTATAGCTTTTTAATGTCAAGTACAGGTCTACGTTGTAAAAATACCACGTGGAATAATA
TTGATACTATGAACTTGACGTGTGGCGCGGGGCATGAAGAATGGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE Acinetobacter baylyi ADP1

42.941

100

0.493

  pilY2 Acinetobacter baumannii D1279779

44.079

100

0.453


Multiple sequence alignment