Detailed information
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | ABFU39_RS05165 | Genome accession | NZ_CP155984 |
| Coordinates | 1233933..1234340 (+) | Length | 135 a.a. |
| NCBI ID | WP_228442818.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. raphani strain LMG 00860 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1194760..1252160 | 1233933..1234340 | within | 0 |
Gene organization within MGE regions
Location: 1194760..1252160
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU39_RS04985 (ABFU39_04975) | - | 1196236..1197516 (+) | 1281 | WP_228442796.1 | SidA/IucD/PvdA family monooxygenase | - |
| ABFU39_RS04990 (ABFU39_04980) | - | 1197570..1197821 (+) | 252 | WP_228442797.1 | hypothetical protein | - |
| ABFU39_RS04995 (ABFU39_04985) | - | 1198240..1198617 (-) | 378 | WP_228442798.1 | hypothetical protein | - |
| ABFU39_RS05000 (ABFU39_04990) | - | 1198614..1198928 (-) | 315 | WP_228442799.1 | hypothetical protein | - |
| ABFU39_RS05005 (ABFU39_04995) | - | 1198985..1199747 (-) | 763 | Protein_970 | hypothetical protein | - |
| ABFU39_RS05010 (ABFU39_05000) | - | 1199909..1200190 (+) | 282 | WP_373046018.1 | helix-turn-helix domain-containing protein | - |
| ABFU39_RS05015 (ABFU39_05005) | dndC | 1200360..1201490 (+) | 1131 | WP_228442802.1 | DNA phosphorothioation system sulfurtransferase DndC | - |
| ABFU39_RS05020 (ABFU39_05010) | - | 1201512..1201727 (+) | 216 | WP_082346685.1 | DNA modification system-associated small protein | - |
| ABFU39_RS05025 (ABFU39_05015) | dndD | 1201717..1203795 (+) | 2079 | WP_228442803.1 | DNA sulfur modification protein DndD | - |
| ABFU39_RS05030 (ABFU39_05020) | - | 1203797..1205326 (+) | 1530 | WP_228442804.1 | ATP-binding protein | - |
| ABFU39_RS05035 (ABFU39_05025) | - | 1205359..1205694 (+) | 336 | WP_228442805.1 | hypothetical protein | - |
| ABFU39_RS05040 (ABFU39_05030) | - | 1205878..1207278 (-) | 1401 | WP_228442806.1 | site-specific integrase | - |
| ABFU39_RS05045 (ABFU39_05035) | - | 1207826..1208050 (+) | 225 | WP_053051249.1 | hypothetical protein | - |
| ABFU39_RS05050 (ABFU39_05040) | - | 1208448..1208927 (+) | 480 | WP_053051250.1 | RadC family protein | - |
| ABFU39_RS05055 (ABFU39_05045) | - | 1209177..1209836 (+) | 660 | WP_228442836.1 | DUF1629 domain-containing protein | - |
| ABFU39_RS05060 (ABFU39_05050) | - | 1209873..1213865 (+) | 3993 | WP_228442807.1 | hypothetical protein | - |
| ABFU39_RS05065 (ABFU39_05055) | - | 1213907..1214557 (+) | 651 | WP_228442808.1 | hypothetical protein | - |
| ABFU39_RS05070 (ABFU39_05060) | - | 1214926..1215465 (+) | 540 | WP_228442809.1 | hypothetical protein | - |
| ABFU39_RS05075 (ABFU39_05065) | - | 1215465..1216706 (+) | 1242 | WP_228442810.1 | DGQHR domain-containing protein | - |
| ABFU39_RS05080 (ABFU39_05070) | - | 1216734..1217864 (+) | 1131 | WP_228442811.1 | ParB N-terminal domain-containing protein | - |
| ABFU39_RS05085 (ABFU39_05075) | - | 1218133..1218462 (-) | 330 | WP_228442812.1 | hypothetical protein | - |
| ABFU39_RS05090 (ABFU39_05080) | - | 1218729..1220324 (+) | 1596 | WP_228442813.1 | MobA/MobL family protein | - |
| ABFU39_RS05095 (ABFU39_05085) | - | 1220377..1220718 (-) | 342 | WP_228442814.1 | hypothetical protein | - |
| ABFU39_RS05100 (ABFU39_05090) | - | 1221541..1221795 (+) | 255 | WP_228442815.1 | hypothetical protein | - |
| ABFU39_RS05105 (ABFU39_05095) | - | 1222086..1222316 (-) | 231 | WP_181920809.1 | hypothetical protein | - |
| ABFU39_RS05110 (ABFU39_05100) | - | 1222380..1222526 (+) | 147 | WP_076054137.1 | hypothetical protein | - |
| ABFU39_RS05115 (ABFU39_05105) | - | 1222710..1223105 (+) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU39_RS05120 (ABFU39_05110) | - | 1223196..1223588 (+) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU39_RS05125 (ABFU39_05115) | glgX | 1224114..1226243 (-) | 2130 | WP_228442816.1 | glycogen debranching protein GlgX | - |
| ABFU39_RS05130 (ABFU39_05120) | rimK | 1226736..1227611 (+) | 876 | WP_116921527.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU39_RS05135 (ABFU39_05125) | - | 1228261..1228938 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU39_RS05140 (ABFU39_05130) | - | 1228931..1230265 (+) | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU39_RS05145 (ABFU39_05135) | - | 1230364..1230619 (-) | 256 | Protein_998 | SymE family type I addiction module toxin | - |
| ABFU39_RS05150 (ABFU39_05140) | coaE | 1230813..1231436 (-) | 624 | WP_225042504.1 | dephospho-CoA kinase | - |
| ABFU39_RS05155 (ABFU39_05145) | - | 1231450..1232313 (-) | 864 | WP_040940797.1 | A24 family peptidase | - |
| ABFU39_RS05160 (ABFU39_05150) | pilC | 1232320..1233582 (-) | 1263 | WP_228442817.1 | type II secretion system F family protein | Machinery gene |
| ABFU39_RS05165 (ABFU39_05155) | pilA/pilAI | 1233933..1234340 (+) | 408 | WP_228442818.1 | pilin | Machinery gene |
| ABFU39_RS05170 (ABFU39_05160) | - | 1234473..1234553 (+) | 81 | WP_407468103.1 | hypothetical protein | - |
| ABFU39_RS05175 (ABFU39_05165) | - | 1234601..1234858 (+) | 258 | WP_407467936.1 | pilin | - |
| ABFU39_RS05180 (ABFU39_05170) | - | 1234917..1236737 (+) | 1821 | WP_323539564.1 | hypothetical protein | - |
| ABFU39_RS05185 (ABFU39_05175) | - | 1236846..1237604 (+) | 759 | WP_228442820.1 | class I SAM-dependent methyltransferase | - |
| ABFU39_RS05190 (ABFU39_05180) | - | 1237636..1238787 (+) | 1152 | WP_228442821.1 | glycosyltransferase family 9 protein | - |
| ABFU39_RS05195 (ABFU39_05185) | - | 1238790..1239632 (-) | 843 | WP_228442822.1 | glycosyltransferase | - |
| ABFU39_RS05200 (ABFU39_05190) | - | 1239626..1240798 (-) | 1173 | WP_228442823.1 | glycosyltransferase | - |
| ABFU39_RS05205 (ABFU39_05195) | - | 1240783..1241646 (-) | 864 | WP_228442824.1 | glycosyltransferase | - |
| ABFU39_RS05210 (ABFU39_05200) | - | 1241696..1242547 (-) | 852 | WP_108133901.1 | glycosyltransferase family 2 protein | - |
| ABFU39_RS05215 (ABFU39_05205) | pilB | 1242703..1244439 (+) | 1737 | WP_040940802.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU39_RS05220 (ABFU39_05210) | pilR | 1245824..1247218 (-) | 1395 | WP_012437607.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU39_RS05225 (ABFU39_05215) | - | 1247427..1249037 (-) | 1611 | WP_228442825.1 | PAS domain-containing sensor histidine kinase | - |
| ABFU39_RS05230 (ABFU39_05220) | sucC | 1249271..1250440 (+) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU39_RS05235 (ABFU39_05225) | sucD | 1250465..1251340 (+) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFU39_RS05240 (ABFU39_05230) | - | 1251477..1251854 (+) | 378 | WP_019237352.1 | CopG family ribbon-helix-helix protein | - |
| ABFU39_RS05245 (ABFU39_05235) | - | 1251858..1252160 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 135 a.a. Molecular weight: 13751.97 Da Isoelectric Point: 8.8610
>NTDB_id=1000719 ABFU39_RS05165 WP_228442818.1 1233933..1234340(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain LMG 00860]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKAQATAGLAEITPGKTQFEVLVNEGSTPTLAGIGLNSPTSRCSSV
VVAATSITCTLRGNASKITGKTLALSRDATTGVWTCQTGGSGGGLDAKYKPAGCS
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKAQATAGLAEITPGKTQFEVLVNEGSTPTLAGIGLNSPTSRCSSV
VVAATSITCTLRGNASKITGKTLALSRDATTGVWTCQTGGSGGGLDAKYKPAGCS
Nucleotide
Download Length: 408 bp
>NTDB_id=1000719 ABFU39_RS05165 WP_228442818.1 1233933..1234340(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain LMG 00860]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGGCACAGGCGACTGCTGGCCTGGCCGAAATCACCCCCGGCAAGACGCAGTTCG
AAGTTCTTGTGAATGAAGGCTCTACCCCTACCCTGGCTGGAATTGGTTTGAACAGCCCAACCTCGCGTTGCAGCAGCGTT
GTAGTAGCCGCAACCAGCATCACTTGCACTTTGAGAGGAAATGCATCCAAGATTACTGGCAAAACCCTTGCTCTTAGTCG
GGACGCTACAACAGGTGTTTGGACCTGCCAAACTGGCGGTTCTGGCGGCGGCTTGGATGCCAAGTACAAGCCCGCCGGTT
GCAGCTGA
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGGCACAGGCGACTGCTGGCCTGGCCGAAATCACCCCCGGCAAGACGCAGTTCG
AAGTTCTTGTGAATGAAGGCTCTACCCCTACCCTGGCTGGAATTGGTTTGAACAGCCCAACCTCGCGTTGCAGCAGCGTT
GTAGTAGCCGCAACCAGCATCACTTGCACTTTGAGAGGAAATGCATCCAAGATTACTGGCAAAACCCTTGCTCTTAGTCG
GGACGCTACAACAGGTGTTTGGACCTGCCAAACTGGCGGTTCTGGCGGCGGCTTGGATGCCAAGTACAAGCCCGCCGGTT
GCAGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
54.286 |
100 |
0.563 |
| pilA | Acinetobacter baumannii strain A118 |
46.528 |
100 |
0.496 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
46.377 |
100 |
0.474 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
44.286 |
100 |
0.459 |
| pilA2 | Legionella pneumophila str. Paris |
43.571 |
100 |
0.452 |
| pilA | Pseudomonas aeruginosa PAK |
38.065 |
100 |
0.437 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
35.758 |
100 |
0.437 |
| pilA | Vibrio cholerae strain A1552 |
40.136 |
100 |
0.437 |
| pilA | Vibrio cholerae C6706 |
40.136 |
100 |
0.437 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
40.136 |
100 |
0.437 |
| pilA/pilA1 | Eikenella corrodens VA1 |
36.667 |
100 |
0.407 |
| pilE | Neisseria gonorrhoeae MS11 |
35.484 |
100 |
0.407 |
| comP | Acinetobacter baylyi ADP1 |
36.184 |
100 |
0.407 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
44.628 |
89.63 |
0.4 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
35.294 |
100 |
0.4 |