Detailed information
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | ABFU31_RS16320 | Genome accession | NZ_CP155950 |
| Coordinates | 3732452..3732850 (-) | Length | 132 a.a. |
| NCBI ID | WP_104570927.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. raphani strain bglFP 6814 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3721348..3745195 | 3732452..3732850 | within | 0 |
Gene organization within MGE regions
Location: 3721348..3745195
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU31_RS16275 (ABFU31_16260) | pilB | 3722333..3724069 (-) | 1737 | WP_040940802.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU31_RS16280 (ABFU31_16265) | - | 3724225..3725076 (+) | 852 | WP_108133901.1 | glycosyltransferase family 2 protein | - |
| ABFU31_RS16285 (ABFU31_16270) | - | 3725126..3725989 (+) | 864 | WP_116921534.1 | glycosyltransferase | - |
| ABFU31_RS16290 (ABFU31_16275) | - | 3725974..3727146 (+) | 1173 | WP_181920810.1 | glycosyltransferase | - |
| ABFU31_RS16295 (ABFU31_16280) | - | 3727140..3727982 (+) | 843 | WP_147308817.1 | glycosyltransferase | - |
| ABFU31_RS16300 (ABFU31_16285) | - | 3727985..3728830 (-) | 846 | WP_323535832.1 | glycosyltransferase family 9 protein | - |
| ABFU31_RS16305 (ABFU31_16290) | - | 3729168..3729926 (-) | 759 | WP_116921530.1 | bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG | - |
| ABFU31_RS16310 (ABFU31_16295) | - | 3730050..3731870 (-) | 1821 | WP_147308815.1 | hypothetical protein | - |
| ABFU31_RS16315 (ABFU31_16300) | - | 3731929..3732351 (-) | 423 | WP_104570926.1 | pilin | - |
| ABFU31_RS16320 (ABFU31_16305) | pilA/pilAI | 3732452..3732850 (-) | 399 | WP_104570927.1 | pilin | Machinery gene |
| ABFU31_RS16325 (ABFU31_16310) | pilC | 3733201..3734463 (+) | 1263 | WP_104570928.1 | type II secretion system F family protein | Machinery gene |
| ABFU31_RS16330 (ABFU31_16315) | - | 3734470..3735333 (+) | 864 | WP_011038216.1 | A24 family peptidase | - |
| ABFU31_RS16335 (ABFU31_16320) | coaE | 3735347..3735970 (+) | 624 | WP_116921528.1 | dephospho-CoA kinase | - |
| ABFU31_RS16340 (ABFU31_16325) | - | 3736164..3736419 (+) | 256 | Protein_3156 | SymE family type I addiction module toxin | - |
| ABFU31_RS16345 (ABFU31_16330) | - | 3736518..3737852 (-) | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU31_RS16350 (ABFU31_16335) | - | 3737845..3738522 (-) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU31_RS16355 (ABFU31_16340) | rimK | 3739172..3740047 (-) | 876 | WP_116921527.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU31_RS16360 (ABFU31_16345) | glgX | 3740541..3742670 (+) | 2130 | WP_116921526.1 | glycogen debranching protein GlgX | - |
| ABFU31_RS16365 (ABFU31_16350) | - | 3743196..3743588 (-) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU31_RS16370 (ABFU31_16355) | - | 3743679..3744074 (-) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU31_RS16375 (ABFU31_16360) | - | 3744258..3744404 (-) | 147 | WP_076054137.1 | hypothetical protein | - |
| ABFU31_RS16380 (ABFU31_16365) | - | 3744468..3744698 (+) | 231 | WP_181920809.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 13656.88 Da Isoelectric Point: 8.8372
>NTDB_id=1000139 ABFU31_RS16320 WP_104570927.1 3732452..3732850(-) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain bglFP 6814]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTVPTTAAQIGLTTPTARCAV
VVSTSGITCTLNGNANKIKGKTISLNRSSADGTWSCVTGGTMDAKYKPAGCS
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEITPGKTQYEVLVNEGTVPTTAAQIGLTTPTARCAV
VVSTSGITCTLNGNANKIKGKTISLNRSSADGTWSCVTGGTMDAKYKPAGCS
Nucleotide
Download Length: 399 bp
>NTDB_id=1000139 ABFU31_RS16320 WP_104570927.1 3732452..3732850(-) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain bglFP 6814]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATTGCGCT
ACCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATCACTCCTGGCAAGACGCAGTATG
AAGTGTTGGTCAACGAAGGTACTGTTCCTACGACGGCCGCCCAGATTGGCTTGACAACGCCGACTGCGCGTTGCGCTGTT
GTCGTAAGCACCTCTGGCATTACATGCACCTTGAATGGCAACGCGAACAAGATTAAAGGCAAAACCATTAGCCTTAACCG
TAGTTCCGCAGATGGTACTTGGAGCTGTGTAACTGGCGGCACCATGGACGCGAAATACAAGCCCGCCGGCTGTTCCTGA
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATTGCGCT
ACCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATCACTCCTGGCAAGACGCAGTATG
AAGTGTTGGTCAACGAAGGTACTGTTCCTACGACGGCCGCCCAGATTGGCTTGACAACGCCGACTGCGCGTTGCGCTGTT
GTCGTAAGCACCTCTGGCATTACATGCACCTTGAATGGCAACGCGAACAAGATTAAAGGCAAAACCATTAGCCTTAACCG
TAGTTCCGCAGATGGTACTTGGAGCTGTGTAACTGGCGGCACCATGGACGCGAAATACAAGCCCGCCGGCTGTTCCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
58.394 |
100 |
0.606 |
| pilA | Acinetobacter baumannii strain A118 |
51.064 |
100 |
0.545 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
46.667 |
100 |
0.477 |
| pilA | Pseudomonas aeruginosa PAK |
41.06 |
100 |
0.47 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
43.066 |
100 |
0.447 |
| pilA2 | Legionella pneumophila str. Paris |
43.066 |
100 |
0.447 |
| comP | Acinetobacter baylyi ADP1 |
39.456 |
100 |
0.439 |
| pilA | Vibrio cholerae strain A1552 |
39.583 |
100 |
0.432 |
| pilA | Vibrio cholerae C6706 |
39.583 |
100 |
0.432 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
39.583 |
100 |
0.432 |
| pilA/pilA1 | Eikenella corrodens VA1 |
36.242 |
100 |
0.409 |
| pilE | Neisseria gonorrhoeae MS11 |
34.416 |
100 |
0.402 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
41.6 |
94.697 |
0.394 |
| pilA | Haemophilus influenzae Rd KW20 |
38.346 |
100 |
0.386 |