TADB

TAfinder detailed results

Overview
Genomic Context
Domains
Sequences
Similar Proteins

Overview

Job ID	wrVbGpMxFf
Sequence name	NZ_CP026085.1 Escherichia coli strain DH5alpha chromosome, complete genome
Predicted type	I

Toxin (Protein)

Predicted family	ldrD (T6328)	Predicted domain	Ldr_toxin (Ldr)
Locus tag	orf197	Length	35 a.a.
Coordinates	211064..211171 (+)

Antitoxin (RNA)

Predicted family	rdlD (AT6344)	Predicted domain	-
Locus tag	NuclAT_23	Length	58 bp
Coordinates	210949..211006 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
orf192	206820..207803	+	984	ORF192	Predicted ORF by PRODIGAL Version 1.20	-
orf193	207800..208804	+	1005	ORF193	Predicted ORF by PRODIGAL Version 1.20	-
orf194	208834..210105	-	1272	ORF194	Predicted ORF by PRODIGAL Version 1.20	-
orf195	210581..210688	+	108	ORF195	Predicted ORF by PRODIGAL Version 1.20	-
orf196	210693..211001	-	309	ORF196	Predicted ORF by PRODIGAL Version 1.20	-
-	210949..211006	-	177	-	-	Antitoxin
orf197	211064..211171	+	108	ORF197	Predicted ORF by PRODIGAL Version 1.20	Toxin
orf198	211547..211654	+	108	ORF198	Predicted ORF by PRODIGAL Version 1.20	-
orf199	211741..213420	-	1680	ORF199	Predicted ORF by PRODIGAL Version 1.20	-
orf200	213417..213608	-	192	ORF200	Predicted ORF by PRODIGAL Version 1.20	-
orf201	213605..215164	-	1560	ORF201	Predicted ORF by PRODIGAL Version 1.20	-
orf202	215449..215637	+	189	ORF202	Predicted ORF by PRODIGAL Version 1.20	-

Domains

The domains were predicted by HMMER and were sorted by score.

Toxin

Ldr_toxin (Ldr) (E-value: 1.9e-27, Score:93.1)

(1-35)

Sequences

Download Length: 35 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157

                                        >ORF197 TA_3 Toxin

MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download Length: 108 bp

                                        >ORF197 TA_3 Toxin

ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCT

GGTATTCTTGCCAGTATGATCGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin

Nucleotide

Download Length: 58 bp

                                        >NuclAT_23 TA_3 Antitoxin

GAGAAAACCCCCGCACGTTGCAGGTATGCACCTGACAACACCACGGGGGCCATTCTTG

Similar Proteins

Only experimentally validated proteins are listed.

Toxin
Antitoxin

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
T6328	Escherichia coli str. K-12 substr. MC4100	97.143	100	0.971
T6348	Escherichia coli K-12 strain ER3413	97.143	100	0.971
T6340	Escherichia coli str. K-12 substr. MDS42	97.143	100	0.971
T6336	Escherichia coli str. K-12 substr. DH10B	97.143	100	0.971
T6344	Escherichia coli str. K-12 substr. W3110	97.143	100	0.971
T6332	Escherichia coli str. K-12 substr. MG1655	97.143	100	0.971
T6326	Escherichia coli str. K-12 substr. MC4100	60	100	0.6
T6346	Escherichia coli K-12 strain ER3413	60	100	0.6
T6338	Escherichia coli str. K-12 substr. MDS42	60	100	0.6
T6334	Escherichia coli str. K-12 substr. DH10B	60	100	0.6
T6342	Escherichia coli str. K-12 substr. W3110	60	100	0.6
T6330	Escherichia coli str. K-12 substr. MG1655	60	100	0.6
T6327	Escherichia coli str. K-12 substr. MC4100	60	100	0.6
T6325	Escherichia coli str. K-12 substr. MC4100	60	100	0.6
T6347	Escherichia coli K-12 strain ER3413	60	100	0.6
T6345	Escherichia coli K-12 strain ER3413	60	100	0.6
T6339	Escherichia coli str. K-12 substr. MDS42	60	100	0.6
T6337	Escherichia coli str. K-12 substr. MDS42	60	100	0.6
T6335	Escherichia coli str. K-12 substr. DH10B	60	100	0.6
T6333	Escherichia coli str. K-12 substr. DH10B	60	100	0.6
T6343	Escherichia coli str. K-12 substr. W3110	60	100	0.6
T6341	Escherichia coli str. K-12 substr. W3110	60	100	0.6
T6331	Escherichia coli str. K-12 substr. MG1655	60	100	0.6
T6329	Escherichia coli str. K-12 substr. MG1655	60	100	0.6

Protein	Organism	Identities (%)	Coverage (%)	H_a-value