Detailed information of TA system TA006346

Experimentally validated

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/-
• Location: 1251512..1251732
• Replicon: chromosome
• Accession: CP009789
• Organism: Escherichia coli K-12 strain ER3413

Toxin (Protein)

• Gene name: rdlD
• Uniprot ID: -
• Locus tag: ER3413_1231
• Protein ID: AIZ51016.1
• Coordinates: 1251512..1251619 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	ER3413_4643
Coordinates	1251667..1251732 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ER3413_1225	1246821..1247903	+	1083	AIZ51009.1	peptide chain release factor RF-1	-
ER3413_1226	1247903..1248736	+	834	AIZ51010.1	N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2	-
ER3413_1227	1248733..1249125	+	393	AIZ51011.1	putative inner membrane protein, SIRB family	-
ER3413_1228	1249129..1249938	+	810	AIZ51012.1	hypothetical protein	-
ER3413_1229	1249974..1250828	+	855	AIZ51013.1	3-deoxy-D-manno-octulosonate 8-phosphate synthase	-
ER3413_1230	1250977..1251084	-	108	AIZ51015.1	toxic polypeptide, small	-
ER3413_1231	1251512..1251619	-	108	AIZ51016.1	toxic polypeptide, small	Toxin
-	1251667..1251732	+	66	-	-	Antitoxin
ER3413_1232	1252047..1252154	-	108	AIZ51017.1	toxic polypeptide, small	-
ER3413_1233	1252558..1253658	-	1101	AIZ51018.1	calcium/sodium:proton antiporter	-
ER3413_1234	1253928..1254158	+	231	AIZ51019.1	cation transport regulator	-
ER3413_1235	1254316..1255011	+	696	AIZ51020.1	cation transport regulator	-
ER3413_1236	1255055..1255408	-	354	AIZ51021.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T6346 AIZ51016.1 CP009789:c1251619-1251512 [Escherichia coli K-12]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T6346 CP009789:c1251619-1251512 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 66 bp

>AT6346 CP009789:1251667-1251732 [Escherichia coli K-12]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T6342	Escherichia coli str. K-12 substr. W3110	100	100	1
T6326	Escherichia coli str. K-12 substr. MC4100	100	100	1
T6338	Escherichia coli str. K-12 substr. MDS42	100	100	1
T6330	Escherichia coli str. K-12 substr. MG1655	100	100	1
T6334	Escherichia coli str. K-12 substr. DH10B	100	100	1
T6335	Escherichia coli str. K-12 substr. DH10B	94.286	100	0.943
T6331	Escherichia coli str. K-12 substr. MG1655	94.286	100	0.943
T6341	Escherichia coli str. K-12 substr. W3110	94.286	100	0.943
T6343	Escherichia coli str. K-12 substr. W3110	94.286	100	0.943
T6333	Escherichia coli str. K-12 substr. DH10B	94.286	100	0.943
T6329	Escherichia coli str. K-12 substr. MG1655	94.286	100	0.943
T6337	Escherichia coli str. K-12 substr. MDS42	94.286	100	0.943
T6339	Escherichia coli str. K-12 substr. MDS42	94.286	100	0.943
T6345	Escherichia coli K-12 strain ER3413	94.286	100	0.943
T6347	Escherichia coli K-12 strain ER3413	94.286	100	0.943
T6325	Escherichia coli str. K-12 substr. MC4100	94.286	100	0.943
T6327	Escherichia coli str. K-12 substr. MC4100	94.286	100	0.943
T6340	Escherichia coli str. K-12 substr. MDS42	57.143	100	0.571
T6336	Escherichia coli str. K-12 substr. DH10B	57.143	100	0.571
T6344	Escherichia coli str. K-12 substr. W3110	57.143	100	0.571
T6328	Escherichia coli str. K-12 substr. MC4100	57.143	100	0.571
T6332	Escherichia coli str. K-12 substr. MG1655	57.143	100	0.571
T6348	Escherichia coli K-12 strain ER3413	57.143	100	0.571

Multiple sequence alignment

Structures

Antitoxin

References

(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]


 experimental literature