Detailed information of TA system TA006326

Experimentally validated

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/-
• Location: 1156871..1157091
• Replicon: chromosome
• Accession: HG738867
• Organism: Escherichia coli str. K-12 substr. MC4100

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: BN896_1042
• Protein ID: CDJ71629.1
• Coordinates: 1156871..1156978 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	BN896_4217
Coordinates	1157026..1157091 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BN896_1036	1152180..1153262	+	1083	CDJ71623.1	peptide chain release factor 1	-
BN896_1037	1153262..1154095	+	834	CDJ71624.1	N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase	-
BN896_1038	1154092..1154484	+	393	CDJ71625.1	putative transcriptional regulator	-
BN896_1039	1154488..1155297	+	810	CDJ71626.1	putative transcriptional regulator	-
BN896_1040	1155333..1156187	+	855	CDJ71627.1	2-dehydro-3-deoxyphosphooctonate aldolase	-
BN896_1041	1156336..1156443	-	108	CDJ71628.1	toxic polypeptide, small	-
BN896_1042	1156871..1156978	-	108	CDJ71629.1	toxic polypeptide, small	Toxin
-	1157026..1157091	+	66	-	-	Antitoxin
BN896_1043	1157406..1157513	-	108	CDJ71630.1	toxic polypeptide, small	-
BN896_1044	1157917..1159017	-	1101	CDJ71631.1	calcium/sodium:proton antiporter	-
BN896_1045	1159287..1159517	+	231	CDJ71632.1	cation transport regulator	-
BN896_1046	1159675..1160370	+	696	CDJ71633.1	regulatory protein for cation transport	-
BN896_1047	1160414..1160767	-	354	CDJ71634.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T6326 CDJ71629.1 HG738867:c1156978-1156871 [Escherichia coli str. K-12 substr. MC4100]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T6326 HG738867:c1156978-1156871 [Escherichia coli str. K-12 substr. MC4100]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 66 bp

>AT6326 HG738867:1157026-1157091 [Escherichia coli str. K-12 substr. MC4100]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T6334	Escherichia coli str. K-12 substr. DH10B	100	100	1
T6330	Escherichia coli str. K-12 substr. MG1655	100	100	1
T6338	Escherichia coli str. K-12 substr. MDS42	100	100	1
T6342	Escherichia coli str. K-12 substr. W3110	100	100	1
T6346	Escherichia coli K-12 strain ER3413	100	100	1
T6335	Escherichia coli str. K-12 substr. DH10B	94.286	100	0.943
T6331	Escherichia coli str. K-12 substr. MG1655	94.286	100	0.943
T6341	Escherichia coli str. K-12 substr. W3110	94.286	100	0.943
T6343	Escherichia coli str. K-12 substr. W3110	94.286	100	0.943
T6333	Escherichia coli str. K-12 substr. DH10B	94.286	100	0.943
T6329	Escherichia coli str. K-12 substr. MG1655	94.286	100	0.943
T6337	Escherichia coli str. K-12 substr. MDS42	94.286	100	0.943
T6339	Escherichia coli str. K-12 substr. MDS42	94.286	100	0.943
T6345	Escherichia coli K-12 strain ER3413	94.286	100	0.943
T6347	Escherichia coli K-12 strain ER3413	94.286	100	0.943
T6325	Escherichia coli str. K-12 substr. MC4100	94.286	100	0.943
T6327	Escherichia coli str. K-12 substr. MC4100	94.286	100	0.943
T6348	Escherichia coli K-12 strain ER3413	57.143	100	0.571
T6340	Escherichia coli str. K-12 substr. MDS42	57.143	100	0.571
T6336	Escherichia coli str. K-12 substr. DH10B	57.143	100	0.571
T6344	Escherichia coli str. K-12 substr. W3110	57.143	100	0.571
T6332	Escherichia coli str. K-12 substr. MG1655	57.143	100	0.571
T6328	Escherichia coli str. K-12 substr. MC4100	57.143	100	0.571

Multiple sequence alignment

Structures

Antitoxin

References

(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]


 experimental literature