Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/- |
| Location | 1270238..1270460 | Replicon | chromosome |
| Accession | NC_000913 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 | ||
| T1TAdb ID | TA06180 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | P0DPD0 |
| Locus tag | b4423 | Protein ID | YP_025299.1 |
| Coordinates | 1270238..1270345 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | b4424 | ||
| Coordinates | 1270401..1270457 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| b1212 | 1266094..1266927 | + | 834 | NP_415730.1 | protein-(glutamine-N(5)) methyltransferase | - |
| b1213 | 1266924..1267316 | + | 393 | NP_415731.1 | SirB family protein YchQ | - |
| b1214 | 1267320..1268129 | + | 810 | NP_415732.1 | transglutaminase-like/TPR repeat-containing protein | - |
| b1215 | 1268165..1269019 | + | 855 | NP_415733.1 | 3-deoxy-D-manno-octulosonate 8-phosphate synthase | - |
| b4419 | 1269168..1269275 | - | 108 | YP_025297.1 | small toxic polypeptide LdrA | - |
| b4421 | 1269703..1269810 | - | 108 | YP_025298.1 | small toxic polypeptide LdrB | - |
| b4423 | 1270238..1270345 | - | 108 | YP_025299.1 | small toxic polypeptide LdrC | Toxin |
| - | 1270401..1270457 | + | 57 | - | - | Antitoxin |
| b1216 | 1270749..1271849 | - | 1101 | NP_415734.1 | Na(+)/K(+):H(+) antiporter ChaA | - |
| b1217 | 1272119..1272349 | + | 231 | NP_415735.1 | putative cation transport regulator ChaB | - |
| b1218 | 1272507..1273202 | + | 696 | NP_415736.2 | glutathione-specific gamma-glutamylcyclotransferase | - |
| b1219 | 1273246..1273599 | - | 354 | NP_415737.1 | DsrE/F sulfur relay family protein YchN | - |
| b1220 | 1273784..1275178 | + | 1395 | NP_415738.2 | putative invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T6331 YP_025299.1 NC_000913:c1270345-1270238 [Escherichia coli str. K-12 substr. MG1655]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T6331 NC_000913:c1270345-1270238 [Escherichia coli str. K-12 substr. MG1655]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT6331 NC_000913:1270401-1270457 [Escherichia coli str. K-12 substr. MG1655]
TCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTC
TCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]
(2) Elizabeth M Fozo et al. (2010) Abundance of type I toxin-antitoxin systems in bacteria: searches for new candidates and discovery of novel families. Nucleic Acids Research 38(11):3743-59. [PubMed:20156992]