Detailed information of TA system TA006328

Experimentally validated

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/-
• Location: 3081074..3081293
• Replicon: chromosome
• Accession: HG738867
• Organism: Escherichia coli str. K-12 substr. MC4100

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: BN896_3227
• Protein ID: CDJ73338.1
• Coordinates: 3081186..3081293 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	BN896_4257
Coordinates	3081074..3081137 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BN896_3231	3076512..3077414	+	903	CDJ73334.1	dipeptide transporter	-
BN896_3230	3077425..3078408	+	984	CDJ73335.1	dipeptide transporter ATP-binding subunit	-
BN896_3229	3078405..3079409	+	1005	CDJ73336.1	dipeptide transporter ATP-binding subunit	-
BN896_3228	3079439..3080710	-	1272	CDJ73337.1	putative transporter	-
-	3081074..3081137	-	64	-	-	Antitoxin
BN896_3227	3081186..3081293	+	108	CDJ73338.1	toxic polypeptide, small	Toxin
BN896_3226	3081380..3083059	-	1680	CDJ73339.1	putative inner membrane protein	-
BN896_3225	3083056..3083247	-	192	CDJ73340.1	hypothetical protein	-
BN896_3224	3083244..3084815	-	1572	CDJ73341.1	hypothetical protein	-
BN896_3223	3085088..3085276	+	189	CDJ73342.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3916.72 Da
• Isoelectric Point: 9.0157

>T6328 CDJ73338.1 HG738867:3081186-3081293 [Escherichia coli str. K-12 substr. MC4100]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

>T6328 HG738867:3081186-3081293 [Escherichia coli str. K-12 substr. MC4100]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin

Nucleotide

• Length: 64 bp

>AT6328 HG738867:c3081137-3081074 [Escherichia coli str. K-12 substr. MC4100]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T6340	Escherichia coli str. K-12 substr. MDS42	100	100	1
T6336	Escherichia coli str. K-12 substr. DH10B	100	100	1
T6344	Escherichia coli str. K-12 substr. W3110	100	100	1
T6332	Escherichia coli str. K-12 substr. MG1655	100	100	1
T6348	Escherichia coli K-12 strain ER3413	100	100	1
T6339	Escherichia coli str. K-12 substr. MDS42	57.143	100	0.571
T6346	Escherichia coli K-12 strain ER3413	57.143	100	0.571
T6345	Escherichia coli K-12 strain ER3413	57.143	100	0.571
T6347	Escherichia coli K-12 strain ER3413	57.143	100	0.571
T6325	Escherichia coli str. K-12 substr. MC4100	57.143	100	0.571
T6326	Escherichia coli str. K-12 substr. MC4100	57.143	100	0.571
T6327	Escherichia coli str. K-12 substr. MC4100	57.143	100	0.571
T6338	Escherichia coli str. K-12 substr. MDS42	57.143	100	0.571
T6334	Escherichia coli str. K-12 substr. DH10B	57.143	100	0.571
T6342	Escherichia coli str. K-12 substr. W3110	57.143	100	0.571
T6330	Escherichia coli str. K-12 substr. MG1655	57.143	100	0.571
T6337	Escherichia coli str. K-12 substr. MDS42	57.143	100	0.571
T6335	Escherichia coli str. K-12 substr. DH10B	57.143	100	0.571
T6333	Escherichia coli str. K-12 substr. DH10B	57.143	100	0.571
T6343	Escherichia coli str. K-12 substr. W3110	57.143	100	0.571
T6341	Escherichia coli str. K-12 substr. W3110	57.143	100	0.571
T6331	Escherichia coli str. K-12 substr. MG1655	57.143	100	0.571
T6329	Escherichia coli str. K-12 substr. MG1655	57.143	100	0.571

Multiple sequence alignment

Structures

Antitoxin

References

(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]


 experimental literature