Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/- |
| Location | 1250977..1251198 | Replicon | chromosome |
| Accession | CP009789 | ||
| Organism | Escherichia coli K-12 strain ER3413 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | - |
| Locus tag | ER3413_1230 | Protein ID | AIZ51015.1 |
| Coordinates | 1250977..1251084 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | ER3413_4642 | ||
| Coordinates | 1251132..1251198 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ER3413_1225 | 1246821..1247903 | + | 1083 | AIZ51009.1 | peptide chain release factor RF-1 | - |
| ER3413_1226 | 1247903..1248736 | + | 834 | AIZ51010.1 | N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2 | - |
| ER3413_1227 | 1248733..1249125 | + | 393 | AIZ51011.1 | putative inner membrane protein, SIRB family | - |
| ER3413_1228 | 1249129..1249938 | + | 810 | AIZ51012.1 | hypothetical protein | - |
| ER3413_1229 | 1249974..1250828 | + | 855 | AIZ51013.1 | 3-deoxy-D-manno-octulosonate 8-phosphate synthase | - |
| ER3413_1230 | 1250977..1251084 | - | 108 | AIZ51015.1 | toxic polypeptide, small | Toxin |
| - | 1251132..1251198 | + | 67 | - | - | Antitoxin |
| ER3413_1231 | 1251512..1251619 | - | 108 | AIZ51016.1 | toxic polypeptide, small | - |
| ER3413_1232 | 1252047..1252154 | - | 108 | AIZ51017.1 | toxic polypeptide, small | - |
| ER3413_1233 | 1252558..1253658 | - | 1101 | AIZ51018.1 | calcium/sodium:proton antiporter | - |
| ER3413_1234 | 1253928..1254158 | + | 231 | AIZ51019.1 | cation transport regulator | - |
| ER3413_1235 | 1254316..1255011 | + | 696 | AIZ51020.1 | cation transport regulator | - |
| ER3413_1236 | 1255055..1255408 | - | 354 | AIZ51021.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T6345 AIZ51015.1 CP009789:c1251084-1250977 [Escherichia coli K-12]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T6345 CP009789:c1251084-1250977 [Escherichia coli K-12]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT6345 CP009789:1251132-1251198 [Escherichia coli K-12]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]