Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/- |
| Location | 1308632..1308853 | Replicon | chromosome |
| Accession | NC_010473 | ||
| Organism | Escherichia coli str. K-12 substr. DH10B | ||
| T1TAdb ID | TA06257 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | ECDH10B_1269 | Protein ID | WP_000170955.1 |
| Coordinates | 1308632..1308739 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | ECDH10B_1270 | ||
| Coordinates | 1308796..1308851 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECDH10B_RS06515 (ECDH10B_1264) | 1304476..1305558 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| ECDH10B_RS06520 (ECDH10B_1265) | 1305558..1306391 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| ECDH10B_RS06525 (ECDH10B_1266) | 1306388..1306780 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| ECDH10B_RS06530 (ECDH10B_1267) | 1306784..1307593 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| ECDH10B_RS06535 (ECDH10B_1268) | 1307629..1308483 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| ECDH10B_RS06540 (ECDH10B_1269) | 1308632..1308739 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | Toxin |
| - | 1308796..1308851 | + | 56 | - | - | Antitoxin |
| ECDH10B_RS06545 (ECDH10B_1271) | 1309167..1309274 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
| ECDH10B_RS06550 (ECDH10B_1273) | 1309702..1309809 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| ECDH10B_RS06555 (ECDH10B_1275) | 1310213..1311313 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| ECDH10B_RS06560 (ECDH10B_1276) | 1311583..1311813 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| ECDH10B_RS06565 (ECDH10B_1277) | 1311971..1312666 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| ECDH10B_RS06570 (ECDH10B_1278) | 1312710..1313063 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T6333 WP_000170955.1 NC_010473:c1308739-1308632 [Escherichia coli str. K-12 substr. DH10B]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T6333 NC_010473:c1308739-1308632 [Escherichia coli str. K-12 substr. DH10B]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 56 bp
>AT6333 NC_010473:1308796-1308851 [Escherichia coli str. K-12 substr. DH10B]
CAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTC
CAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]
(2) Elizabeth M Fozo et al. (2010) Abundance of type I toxin-antitoxin systems in bacteria: searches for new candidates and discovery of novel families. Nucleic Acids Research 38(11):3743-59. [PubMed:20156992]