Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/- |
| Location | 1075131..1075351 | Replicon | chromosome |
| Accession | NC_020518 | ||
| Organism | Escherichia coli str. K-12 substr. MDS42 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | ECMDS42_1005 | Protein ID | WP_000170963.1 |
| Coordinates | 1075131..1075238 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | ECMDS42_1006 | ||
| Coordinates | 1075286..1075351 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECMDS42_RS05150 (ECMDS42_0998) | 1070440..1071522 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| ECMDS42_RS05155 (ECMDS42_0999) | 1071522..1072355 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| ECMDS42_RS05160 (ECMDS42_1000) | 1072352..1072744 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| ECMDS42_RS05165 (ECMDS42_1001) | 1072748..1073557 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| ECMDS42_RS05170 (ECMDS42_1002) | 1073593..1074447 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| ECMDS42_RS05175 (ECMDS42_1003) | 1074596..1074703 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| ECMDS42_RS05180 (ECMDS42_1005) | 1075131..1075238 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1075286..1075351 | + | 66 | - | - | Antitoxin |
| ECMDS42_RS05185 (ECMDS42_1007) | 1075666..1075773 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| ECMDS42_RS05190 (ECMDS42_1009) | 1076177..1077277 | - | 1101 | WP_015439377.1 | sodium-potassium/proton antiporter ChaA | - |
| ECMDS42_RS05195 (ECMDS42_1010) | 1077547..1077777 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| ECMDS42_RS05200 (ECMDS42_1011) | 1077935..1078630 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| ECMDS42_RS05205 (ECMDS42_1012) | 1078674..1079027 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T6338 WP_000170963.1 NC_020518:c1075238-1075131 [Escherichia coli str. K-12 substr. MDS42]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T6338 NC_020518:c1075238-1075131 [Escherichia coli str. K-12 substr. MDS42]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT6338 NC_020518:1075286-1075351 [Escherichia coli str. K-12 substr. MDS42]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]