Detailed information of TA system
Experimentally validatedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/- |
Location | 1156336..1156557 | Replicon | chromosome |
Accession | HG738867 | ||
Organism | Escherichia coli str. K-12 substr. MC4100 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | - |
Locus tag | BN896_1041 | Protein ID | CDJ71628.1 |
Coordinates | 1156336..1156443 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | BN896_4216 | ||
Coordinates | 1156491..1156557 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN896_1036 | 1152180..1153262 | + | 1083 | CDJ71623.1 | peptide chain release factor 1 | - |
BN896_1037 | 1153262..1154095 | + | 834 | CDJ71624.1 | N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase | - |
BN896_1038 | 1154092..1154484 | + | 393 | CDJ71625.1 | putative transcriptional regulator | - |
BN896_1039 | 1154488..1155297 | + | 810 | CDJ71626.1 | putative transcriptional regulator | - |
BN896_1040 | 1155333..1156187 | + | 855 | CDJ71627.1 | 2-dehydro-3-deoxyphosphooctonate aldolase | - |
BN896_1041 | 1156336..1156443 | - | 108 | CDJ71628.1 | toxic polypeptide, small | Toxin |
- | 1156491..1156557 | + | 67 | - | - | Antitoxin |
BN896_1042 | 1156871..1156978 | - | 108 | CDJ71629.1 | toxic polypeptide, small | - |
BN896_1043 | 1157406..1157513 | - | 108 | CDJ71630.1 | toxic polypeptide, small | - |
BN896_1044 | 1157917..1159017 | - | 1101 | CDJ71631.1 | calcium/sodium:proton antiporter | - |
BN896_1045 | 1159287..1159517 | + | 231 | CDJ71632.1 | cation transport regulator | - |
BN896_1046 | 1159675..1160370 | + | 696 | CDJ71633.1 | regulatory protein for cation transport | - |
BN896_1047 | 1160414..1160767 | - | 354 | CDJ71634.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T6325 CDJ71628.1 HG738867:c1156443-1156336 [Escherichia coli str. K-12 substr. MC4100]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T6325 HG738867:c1156443-1156336 [Escherichia coli str. K-12 substr. MC4100]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT6325 HG738867:1156491-1156557 [Escherichia coli str. K-12 substr. MC4100]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Multiple sequence alignment
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
References
(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]
experimental literature