Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/- |
| Location | 3940216..3940435 | Replicon | chromosome |
| Accession | NC_007779 | ||
| Organism | Escherichia coli str. K-12 substr. W3110 | ||
| T1TAdb ID | TA06177 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | Y75_p3638 | Protein ID | WP_000141634.1 |
| Coordinates | 3940328..3940435 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | Y75_s0046 | ||
| Coordinates | 3940213..3940279 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Y75_RS19515 (Y75_p3634) | 3935654..3936556 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| Y75_RS19520 (Y75_p3635) | 3936567..3937550 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| Y75_RS19525 (Y75_p3636) | 3937547..3938551 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| Y75_RS19530 (Y75_p3637) | 3938581..3939852 | - | 1272 | WP_001295225.1 | transporter | - |
| - | 3940213..3940279 | - | 67 | - | - | Antitoxin |
| Y75_RS19540 (Y75_p3638) | 3940328..3940435 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| Y75_RS19545 (Y75_p3639) | 3940522..3942201 | - | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| Y75_RS19550 (Y75_p3640) | 3942198..3942389 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| Y75_RS19555 (Y75_p3641) | 3942386..3943957 | - | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
| Y75_RS19560 (Y75_p3642) | 3944230..3944418 | + | 189 | WP_001063318.1 | YhjR family protein | - |
| Y75_RS19565 (Y75_p3643) | 3944430..3945182 | + | 753 | Protein_3700 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T6344 WP_000141634.1 NC_007779:3940328-3940435 [Escherichia coli str. K-12 substr. W3110]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T6344 NC_007779:3940328-3940435 [Escherichia coli str. K-12 substr. W3110]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT6344 NC_007779:c3940279-3940213 [Escherichia coli str. K-12 substr. W3110]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]
(2) Elizabeth M Fozo et al. (2010) Abundance of type I toxin-antitoxin systems in bacteria: searches for new candidates and discovery of novel families. Nucleic Acids Research 38(11):3743-59. [PubMed:20156992]