Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/- |
| Location | 3795748..3795967 | Replicon | chromosome |
| Accession | NC_010473 | ||
| Organism | Escherichia coli str. K-12 substr. DH10B | ||
| T1TAdb ID | TA06260 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | ECDH10B_3716 | Protein ID | WP_000141634.1 |
| Coordinates | 3795748..3795855 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | ECDH10B_3717 | ||
| Coordinates | 3795903..3795969 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECDH10B_RS18875 (ECDH10B_3711) | 3791001..3791753 | - | 753 | Protein_3600 | cellulose biosynthesis protein BcsQ | - |
| ECDH10B_RS18880 (ECDH10B_3712) | 3791765..3791953 | - | 189 | WP_001063318.1 | YhjR family protein | - |
| ECDH10B_RS18885 | 3792226..3793797 | + | 1572 | WP_001204927.1 | cellulose biosynthesis protein BcsE | - |
| ECDH10B_RS18890 (ECDH10B_3714) | 3793794..3793985 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| ECDH10B_RS18895 (ECDH10B_3715) | 3793982..3795661 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| ECDH10B_RS18900 (ECDH10B_3716) | 3795748..3795855 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 3795903..3795969 | + | 67 | - | - | Antitoxin |
| ECDH10B_RS18910 (ECDH10B_3718) | 3796331..3797602 | + | 1272 | WP_001295225.1 | transporter | - |
| ECDH10B_RS18915 (ECDH10B_3719) | 3797632..3798636 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| ECDH10B_RS18920 (ECDH10B_3720) | 3798633..3799616 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| ECDH10B_RS18925 (ECDH10B_3721) | 3799627..3800529 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T6336 WP_000141634.1 NC_010473:c3795855-3795748 [Escherichia coli str. K-12 substr. DH10B]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T6336 NC_010473:c3795855-3795748 [Escherichia coli str. K-12 substr. DH10B]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT6336 NC_010473:3795903-3795969 [Escherichia coli str. K-12 substr. DH10B]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Mitsuoki Kawano et al. (2002) Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli. Molecular Microbiology 45(2):333-49. [PubMed:12123448]
(2) Elizabeth M Fozo et al. (2010) Abundance of type I toxin-antitoxin systems in bacteria: searches for new candidates and discovery of novel families. Nucleic Acids Research 38(11):3743-59. [PubMed:20156992]