TAfinder detailed results

Overview


Job ID wrVbGpMxFf
Sequence name NZ_CP026085.1 Escherichia coli strain DH5alpha chromosome, complete genome
Predicted type I

Toxin (Protein)


Predicted family ldrD (T6328) Predicted domain Ldr_toxin (Ldr)
Locus tag orf195 Length 35 a.a.
Coordinates 210581..210688 (+)

Antitoxin (RNA)


Predicted family rdlD (AT6344) Predicted domain -
Locus tag NuclAT_22 Length 67 bp
Coordinates 210466..210532 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
orf191 205907..206809 + 903 ORF191 Predicted ORF by PRODIGAL Version 1.20 -
orf192 206820..207803 + 984 ORF192 Predicted ORF by PRODIGAL Version 1.20 -
orf193 207800..208804 + 1005 ORF193 Predicted ORF by PRODIGAL Version 1.20 -
orf194 208834..210105 - 1272 ORF194 Predicted ORF by PRODIGAL Version 1.20 -
- 210466..210532 - 204 - - Antitoxin
orf195 210581..210688 + 108 ORF195 Predicted ORF by PRODIGAL Version 1.20 Toxin
orf196 210693..211001 - 309 ORF196 Predicted ORF by PRODIGAL Version 1.20 -
orf197 211064..211171 + 108 ORF197 Predicted ORF by PRODIGAL Version 1.20 -
orf198 211547..211654 + 108 ORF198 Predicted ORF by PRODIGAL Version 1.20 -
orf199 211741..213420 - 1680 ORF199 Predicted ORF by PRODIGAL Version 1.20 -
orf200 213417..213608 - 192 ORF200 Predicted ORF by PRODIGAL Version 1.20 -
orf201 213605..215164 - 1560 ORF201 Predicted ORF by PRODIGAL Version 1.20 -
orf202 215449..215637 + 189 ORF202 Predicted ORF by PRODIGAL Version 1.20 -

Domains


The domains were predicted by HMMER and were sorted by score.

Toxin

Ldr_toxin (Ldr) (E-value: 1.9e-27, Score:93.1)

(1-35)


Sequences


Toxin        


Download         Length: 35 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>ORF195 TA_2 Toxin
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>ORF195 TA_2 Toxin
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCT
GGCATTCTTGCCAGTATGATCGTGAACTGGCTGAACAAGCGGAAGTAG

Antitoxin


Download         Length: 67 bp

>NuclAT_22 TA_2 Antitoxin
GAGAAAACCCCCGCACGTTGCAGGTATGTACCTGACAACATAACGGGGGCTAATCTTGAA
CCTAGAC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value