Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | R8474_RS09620 | Genome accession | NZ_AP026914 |
| Coordinates | 1883014..1883340 (-) | Length | 108 a.a. |
| NCBI ID | WP_000738625.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain PZ900700003 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1878014..1888340
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8474_RS09575 (PC0003_18710) | rnpA | 1878033..1878404 (-) | 372 | WP_000739244.1 | ribonuclease P protein component | - |
| R8474_RS09580 | - | 1878421..1878552 (-) | 132 | WP_000768904.1 | hypothetical protein | - |
| R8474_RS09585 (PC0003_18720) | - | 1878553..1879743 (-) | 1191 | WP_000167769.1 | acetate kinase | - |
| R8474_RS09590 (PC0003_18730) | comYH | 1879794..1880747 (-) | 954 | WP_000345127.1 | class I SAM-dependent methyltransferase | Machinery gene |
| R8474_RS09595 | - | 1880808..1881402 (-) | 595 | Protein_1869 | class I SAM-dependent methyltransferase | - |
| R8474_RS09600 (PC0003_18760) | comGG/cglG | 1881558..1881950 (-) | 393 | WP_001818028.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| R8474_RS09605 | comGF/cglF | 1881928..1882389 (-) | 462 | WP_000250539.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| R8474_RS09610 (PC0003_18780) | comGE/cglE | 1882352..1882654 (-) | 303 | WP_000413382.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| R8474_RS09615 (PC0003_18790) | comGD/cglD | 1882617..1883021 (-) | 405 | WP_000588030.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| R8474_RS09620 (PC0003_18800) | comGC/cglC | 1883014..1883340 (-) | 327 | WP_000738625.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| R8474_RS09625 (PC0003_18810) | comGB/cglB | 1883342..1884358 (-) | 1017 | WP_074017570.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| R8474_RS09630 (PC0003_18820) | comGA/cglA/cilD | 1884306..1885247 (-) | 942 | WP_000249549.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| R8474_RS09635 (PC0003_18830) | - | 1885323..1885688 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| R8474_RS09640 (PC0003_18840) | - | 1885839..1886897 (-) | 1059 | WP_000649466.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| R8474_RS09645 (PC0003_18850) | nagA | 1887060..1888211 (-) | 1152 | WP_001134459.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
Sequence
Protein
Download Length: 108 a.a. Molecular weight: 12143.28 Da Isoelectric Point: 10.0055
>NTDB_id=97524 R8474_RS09620 WP_000738625.1 1883014..1883340(-) (comGC/cglC) [Streptococcus pneumoniae strain PZ900700003]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLDKNEDATLSKLQG
DGRITEEQVKAYNEYYTKNGGANRKVND
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLDKNEDATLSKLQG
DGRITEEQVKAYNEYYTKNGGANRKVND
Nucleotide
Download Length: 327 bp
>NTDB_id=97524 R8474_RS09620 WP_000738625.1 1883014..1883340(-) (comGC/cglC) [Streptococcus pneumoniae strain PZ900700003]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTAGTAGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGATAAAAATGAAGATGCTACTCTGAGCAAGTTACAAGGA
GATGGGCGCATCACGGAAGAACAGGTTAAAGCTTATAATGAATACTATACTAAAAATGGAGGGGCAAATCGTAAAGTCAA
TGATTAA
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTAGTAGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGATAAAAATGAAGATGCTACTCTGAGCAAGTTACAAGGA
GATGGGCGCATCACGGAAGAACAGGTTAAAGCTTATAATGAATACTATACTAAAAATGGAGGGGCAAATCGTAAAGTCAA
TGATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus mitis SK321 |
95.37 |
100 |
0.954 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
92.593 |
100 |
0.926 |
| comGC/cglC | Streptococcus pneumoniae D39 |
92.593 |
100 |
0.926 |
| comGC/cglC | Streptococcus pneumoniae R6 |
92.593 |
100 |
0.926 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
92.593 |
100 |
0.926 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
92.857 |
90.741 |
0.843 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
67.961 |
95.37 |
0.648 |
| comYC | Streptococcus mutans UA140 |
62.745 |
94.444 |
0.593 |
| comYC | Streptococcus mutans UA159 |
62.745 |
94.444 |
0.593 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
56.863 |
94.444 |
0.537 |
| comYC | Streptococcus suis isolate S10 |
64.773 |
81.481 |
0.528 |
| comGC | Staphylococcus aureus MW2 |
47.674 |
79.63 |
0.38 |
| comGC | Staphylococcus aureus N315 |
47.674 |
79.63 |
0.38 |