Detailed information NTG0097520

Bioinformatically predicted

Overview

• Name: comGG/cglG
• Type: Machinery gene
• Locus tag: R8474_RS09600
• Genome accession: NZ_AP026914
• Coordinates: 1881558..1881950 (-)
• Length: 130 a.a.
• NCBI ID: WP_001818028.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain PZ900700003
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1876558..1886950

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R8474_RS09570 (PC0003_18700)	-	1877234..1878058 (-)	825	WP_001832473.1	membrane protein insertase YidC	-
R8474_RS09575 (PC0003_18710)	rnpA	1878033..1878404 (-)	372	WP_000739244.1	ribonuclease P protein component	-
R8474_RS09580	-	1878421..1878552 (-)	132	WP_000768904.1	hypothetical protein	-
R8474_RS09585 (PC0003_18720)	-	1878553..1879743 (-)	1191	WP_000167769.1	acetate kinase	-
R8474_RS09590 (PC0003_18730)	comYH	1879794..1880747 (-)	954	WP_000345127.1	class I SAM-dependent methyltransferase	Machinery gene
R8474_RS09595	-	1880808..1881402 (-)	595	Protein_1869	class I SAM-dependent methyltransferase	-
R8474_RS09600 (PC0003_18760)	comGG/cglG	1881558..1881950 (-)	393	WP_001818028.1	competence type IV pilus minor pilin ComGG	Machinery gene
R8474_RS09605	comGF/cglF	1881928..1882389 (-)	462	WP_000250539.1	competence type IV pilus minor pilin ComGF	Machinery gene
R8474_RS09610 (PC0003_18780)	comGE/cglE	1882352..1882654 (-)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
R8474_RS09615 (PC0003_18790)	comGD/cglD	1882617..1883021 (-)	405	WP_000588030.1	competence type IV pilus minor pilin ComGD	Machinery gene
R8474_RS09620 (PC0003_18800)	comGC/cglC	1883014..1883340 (-)	327	WP_000738625.1	competence type IV pilus major pilin ComGC	Machinery gene
R8474_RS09625 (PC0003_18810)	comGB/cglB	1883342..1884358 (-)	1017	WP_074017570.1	competence type IV pilus assembly protein ComGB	Machinery gene
R8474_RS09630 (PC0003_18820)	comGA/cglA/cilD	1884306..1885247 (-)	942	WP_000249549.1	competence type IV pilus ATPase ComGA	Machinery gene
R8474_RS09635 (PC0003_18830)	-	1885323..1885688 (-)	366	WP_000286415.1	DUF1033 family protein	-
R8474_RS09640 (PC0003_18840)	-	1885839..1886897 (-)	1059	WP_000649466.1	zinc-dependent alcohol dehydrogenase family protein	-

Sequence

Protein

• Length: 130 a.a.
• Molecular weight: 15071.47 Da
• Isoelectric Point: 10.3982

>NTDB_id=97520 R8474_RS09600 WP_001818028.1 1881558..1881950(-) (comGG/cglG) [Streptococcus pneumoniae strain PZ900700003]
MWKKKKVKAGVLLYAVTIAAIFSLLLQFYLNRQIAHYQDYALNKEKLVAFAMAKRTKDKAEQESGEQVFNLGQVSYQNKK
TSLVTTVRTSKSQYEFLFPSVKIKEEKRDKKEEVATDSSEKAEKKIRREA

Nucleotide

• Length: 393 bp

>NTDB_id=97520 R8474_RS09600 WP_001818028.1 1881558..1881950(-) (comGG/cglG) [Streptococcus pneumoniae strain PZ900700003]
GTGTGGAAAAAGAAGAAAGTTAAGGCAGGTGTTCTCCTCTACGCAGTCACCATAGCAGCCATCTTTAGTCTTTTGTTGCA
ATTTTATTTGAACCGACAAATCGCCCACTATCAAGACTATGCTTTAAATAAAGAAAAATTGGTTGCTTTTGCCATGGCTA
AACGAACCAAGGATAAAGCCGAGCAAGAAAGTGGGGAACAGGTTTTTAATCTAGGTCAGGTAAGCTATCAAAACAAGAAA
ACAAGCTTGGTGACGACTGTTCGTACGTCTAAGAGCCAATATGAGTTTCTGTTTCCTTCAGTCAAAATCAAAGAAGAGAA
AAGAGATAAAAAGGAAGAGGTAGCGACCGATTCAAGCGAAAAAGCGGAGAAAAAAATCAGAAGAGAAGCCTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG/cglG	Streptococcus pneumoniae TIGR4	94.872	90	0.854
comGG/cglG	Streptococcus pneumoniae Rx1	94.872	90	0.854
comGG/cglG	Streptococcus pneumoniae D39	94.872	90	0.854
comGG/cglG	Streptococcus pneumoniae R6	94.872	90	0.854
comGG/cglG	Streptococcus mitis NCTC 12261	89.344	93.846	0.838
comGG/cglG	Streptococcus mitis SK321	86.066	93.846	0.808
comYG	Streptococcus mutans UA140	38.76	99.231	0.385
comYG	Streptococcus mutans UA159	38.76	99.231	0.385