NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	V6U69_RS00725	Genome accession	NZ_CP145867
Coordinates	133953..134267 (+)	Length	104 a.a.
NCBI ID	WP_037611125.1	Uniprot ID	-
Organism	Streptococcus salivarius strain KSS10
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 128953..139267

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6U69_RS00710 (V6U69_00710)	-	131579..131941 (+)	363	WP_002885749.1	DUF1033 family protein	-
V6U69_RS00715 (V6U69_00715)	comYA	132021..132962 (+)	942	WP_002885658.1	competence type IV pilus ATPase ComGA	Machinery gene
V6U69_RS00720 (V6U69_00720)	comYB	132844..133944 (+)	1101	WP_155115607.1	competence type IV pilus assembly protein ComGB	Machinery gene
V6U69_RS00725 (V6U69_00725)	comYC	133953..134267 (+)	315	WP_037611125.1	competence type IV pilus major pilin ComGC	Machinery gene
V6U69_RS00730 (V6U69_00730)	comYD	134227..134655 (+)	429	WP_260312930.1	competence type IV pilus minor pilin ComGD	Machinery gene
V6U69_RS00735 (V6U69_00735)	comGE	134687..134917 (+)	231	WP_002887015.1	competence type IV pilus minor pilin ComGE	-
V6U69_RS00740 (V6U69_00740)	comYF	134904..135341 (+)	438	WP_022496100.1	competence type IV pilus minor pilin ComGF	Machinery gene
V6U69_RS00745 (V6U69_00745)	comGG	135319..135636 (+)	318	WP_021144683.1	competence type IV pilus minor pilin ComGG	-
V6U69_RS00750 (V6U69_00750)	comYH	135681..136637 (+)	957	WP_410533909.1	class I SAM-dependent methyltransferase	Machinery gene
V6U69_RS00755 (V6U69_00755)	-	136694..137887 (+)	1194	WP_410533911.1	acetate kinase	-
V6U69_RS00760 (V6U69_00760)	-	138138..138335 (+)	198	WP_013991261.1	helix-turn-helix transcriptional regulator	-
V6U69_RS00765 (V6U69_00765)	-	138347..139003 (+)	657	WP_410533913.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

Download Length: 104 a.a. Molecular weight: 11428.31 Da Isoelectric Point: 9.7150

                                >NTDB_id=940757 V6U69_RS00725 WP_037611125.1 133953..134267(+) (comYC) [Streptococcus salivarius strain KSS10]

MKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVSEGQI

TQKQADSYNDYYAKHGGESRSVAN

Nucleotide

Download Length: 315 bp

                                >NTDB_id=940757 V6U69_RS00725 WP_037611125.1 133953..134267(+) (comYC) [Streptococcus salivarius strain KSS10]

TTGAAAAAATTGAATGCCGTTAAATTACGTGCTTTTACGCTGATTGAAATGCTGGTCGTGCTTCTCATTATCAGTATTCT

CCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTGTGGTCAAGGTCG

TGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCAGAAGGTCAAATC

ACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGCCAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(10-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus mutans UA140	70.192	100	0.702
comYC	Streptococcus mutans UA159	70.192	100	0.702
comYC	Streptococcus gordonii str. Challis substr. CH1	64.762	100	0.654
comGC/cglC	Streptococcus mitis SK321	63.636	95.192	0.606
comGC/cglC	Streptococcus mitis NCTC 12261	59.406	97.115	0.577
comGC	Lactococcus lactis subsp. cremoris KW2	58.416	97.115	0.567
comGC/cglC	Streptococcus pneumoniae R6	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae Rx1	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae TIGR4	59.596	95.192	0.567
comGC/cglC	Streptococcus pneumoniae D39	59.596	95.192	0.567
comYC	Streptococcus suis isolate S10	61.364	84.615	0.519
comGC	Staphylococcus aureus MW2	50	75	0.375
comGC	Staphylococcus aureus N315	50	75	0.375

Detailed information NTG0940757