Detailed information NTG0940746

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: V6U68_RS09410
• Genome accession: NZ_CP145866
• Coordinates: 2015366..2015692 (-)
• Length: 108 a.a.
• NCBI ID: WP_002885815.1
• Uniprot ID: -
• Organism: Streptococcus salivarius strain KSS9
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2010366..2020692

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6U68_RS09370 (V6U68_09350)	-	2010630..2011286 (-)	657	WP_037601483.1	CPBP family intramembrane glutamic endopeptidase	-
V6U68_RS09375 (V6U68_09355)	-	2011298..2011495 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
V6U68_RS09380 (V6U68_09360)	-	2011746..2012939 (-)	1194	WP_003095894.1	acetate kinase	-
V6U68_RS09385 (V6U68_09365)	comYH	2012996..2013952 (-)	957	WP_037601477.1	class I SAM-dependent methyltransferase	Machinery gene
V6U68_RS09390 (V6U68_09370)	comGG	2013997..2014314 (-)	318	WP_041817287.1	competence type IV pilus minor pilin ComGG	-
V6U68_RS09395 (V6U68_09375)	comYF	2014292..2014729 (-)	438	WP_080611747.1	competence type IV pilus minor pilin ComGF	Machinery gene
V6U68_RS09400 (V6U68_09380)	comGE	2014716..2015006 (-)	291	WP_195435963.1	competence type IV pilus minor pilin ComGE	-
V6U68_RS09405 (V6U68_09385)	comYD	2014978..2015406 (-)	429	WP_267472584.1	competence type IV pilus minor pilin ComGD	Machinery gene
V6U68_RS09410 (V6U68_09390)	comYC	2015366..2015692 (-)	327	WP_002885815.1	competence type IV pilus major pilin ComGC	Machinery gene
V6U68_RS09415 (V6U68_09395)	comYB	2015689..2016789 (-)	1101	WP_410531677.1	competence type IV pilus assembly protein ComGB	Machinery gene
V6U68_RS09420 (V6U68_09400)	comYA	2016671..2017612 (-)	942	WP_201041167.1	competence type IV pilus ATPase ComGA	Machinery gene
V6U68_RS09425 (V6U68_09405)	-	2017692..2018054 (-)	363	WP_073949471.1	DUF1033 family protein	-
V6U68_RS09430 (V6U68_09410)	-	2018266..2019515 (+)	1250	Protein_1801	ISL3 family transposase	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11932.03 Da
• Isoelectric Point: 9.9219

>NTDB_id=940746 V6U68_RS09410 WP_002885815.1 2015366..2015692(-) (comYC) [Streptococcus salivarius strain KSS9]
MKMMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=940746 V6U68_RS09410 WP_002885815.1 2015366..2015692(-) (comYC) [Streptococcus salivarius strain KSS9]
ATGAAAATGATGTTAAAAAAATTGAATGCCGTTAAACTACGAGCTTTTACACTAATCGAAATGCTAGTCGTGCTTCTCAT
TATCAGTATTCTCCTCTTGCTTTTTGTTCCTAACTTGAGTAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTG
TGGTCAAGGTCGTGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCAGCTCTTGTTTCA
GAAGGTCAAATCACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGC
CAACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361