NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	V6T26_RS00705	Genome accession	NZ_CP145858
Coordinates	130054..130380 (+)	Length	108 a.a.
NCBI ID	WP_410541296.1	Uniprot ID	-
Organism	Streptococcus salivarius strain KSS11
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 125054..135380

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6T26_RS00690 (V6T26_00690)	-	127691..128053 (+)	363	WP_002887019.1	DUF1033 family protein	-
V6T26_RS00695 (V6T26_00695)	comYA	128134..129075 (+)	942	WP_410541295.1	competence type IV pilus ATPase ComGA	Machinery gene
V6T26_RS00700 (V6T26_00700)	comYB	128957..130057 (+)	1101	WP_410531677.1	competence type IV pilus assembly protein ComGB	Machinery gene
V6T26_RS00705 (V6T26_00705)	comYC	130054..130380 (+)	327	WP_410541296.1	competence type IV pilus major pilin ComGC	Machinery gene
V6T26_RS00710 (V6T26_00710)	comYD	130340..130768 (+)	429	WP_253183867.1	competence type IV pilus minor pilin ComGD	Machinery gene
V6T26_RS00715 (V6T26_00715)	comGE	130740..131030 (+)	291	WP_073689936.1	competence type IV pilus minor pilin ComGE	-
V6T26_RS00720 (V6T26_00720)	comYF	131017..131454 (+)	438	WP_037600123.1	competence type IV pilus minor pilin ComGF	Machinery gene
V6T26_RS00725 (V6T26_00725)	comGG	131432..131749 (+)	318	WP_155222523.1	competence type IV pilus minor pilin ComGG	-
V6T26_RS00730 (V6T26_00730)	comYH	131794..132750 (+)	957	WP_155222522.1	class I SAM-dependent methyltransferase	Machinery gene
V6T26_RS00735 (V6T26_00735)	-	132807..134000 (+)	1194	WP_003095894.1	acetate kinase	-
V6T26_RS00740 (V6T26_00740)	-	134251..134448 (+)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
V6T26_RS00745 (V6T26_00745)	-	134460..135116 (+)	657	WP_410541297.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

Download Length: 108 a.a. Molecular weight: 11902.00 Da Isoelectric Point: 9.9219

                                >NTDB_id=940221 V6T26_RS00705 WP_410541296.1 130054..130380(+) (comYC) [Streptococcus salivarius strain KSS11]

MKMMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKAASLAALVS

EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

Download Length: 327 bp

                                >NTDB_id=940221 V6T26_RS00705 WP_410541296.1 130054..130380(+) (comYC) [Streptococcus salivarius strain KSS11]

ATGAAAATGATGTTAAAAAAATTGAATGCCGTTAAACTACGAGCTTTTACGCTAATTGAAATGCTAGTCGTGCTTCTCAT

TATCAGTATTCTCCTCTTGCTTTTTGTTCCTAACTTGAGTAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCAGCTG

TGGTCAAGGTCGTGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGGCAGCTAGCTTAGCAGCTCTTGTTTCA

GAAGGTCAAATCACGCAAAAACAGGCAGATTCATACAATGATTATTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGC

CAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(14-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361

Detailed information NTG0940221