NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	SM123_RS09970	Genome accession	NZ_CP139419
Coordinates	2059103..2059420 (-)	Length	105 a.a.
NCBI ID	WP_101770912.1	Uniprot ID	-
Organism	Streptococcus lingualis strain S5
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2054103..2064420

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SM123_RS09935 (SM123_09935)	-	2054557..2055288 (-)	732	WP_320909533.1	type II CAAX endopeptidase family protein	-
SM123_RS09940 (SM123_09940)	-	2055361..2056554 (-)	1194	WP_023919646.1	acetate kinase	-
SM123_RS09945 (SM123_09945)	comYH	2056606..2057559 (-)	954	WP_049505971.1	class I SAM-dependent methyltransferase	Machinery gene
SM123_RS09950 (SM123_09950)	comGG	2057590..2058057 (-)	468	WP_320909534.1	competence type IV pilus minor pilin ComGG	-
SM123_RS09955 (SM123_09955)	comGF/cglF	2058014..2058466 (-)	453	WP_151190960.1	competence type IV pilus minor pilin ComGF	Machinery gene
SM123_RS09960 (SM123_09960)	comGE	2058456..2058743 (-)	288	WP_151190959.1	competence type IV pilus minor pilin ComGE	-
SM123_RS09965 (SM123_09965)	comYD	2058709..2059113 (-)	405	WP_269796580.1	competence type IV pilus minor pilin ComGD	Machinery gene
SM123_RS09970 (SM123_09970)	comYC	2059103..2059420 (-)	318	WP_101770912.1	competence type IV pilus major pilin ComGC	Machinery gene
SM123_RS09975 (SM123_09975)	comYB	2059417..2060448 (-)	1032	WP_320910010.1	competence type IV pilus assembly protein ComGB	Machinery gene
SM123_RS09980 (SM123_09980)	comYA	2060381..2061322 (-)	942	WP_320909535.1	competence type IV pilus ATPase ComGA	Machinery gene
SM123_RS09985 (SM123_09985)	-	2061410..2061799 (-)	390	WP_037608454.1	DUF1033 family protein	-
SM123_RS09990 (SM123_09990)	-	2062020..2063123 (-)	1104	WP_049475202.1	glycosyl hydrolase family 8	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11659.59 Da Isoelectric Point: 9.6248

                                >NTDB_id=909569 SM123_RS09970 WP_101770912.1 2059103..2059420(-) (comYC) [Streptococcus lingualis strain S5]

MKKLKTYKVKAFTLIEMLVVLLIISVLLLLFVPNLTKQKDSVKETGNAAVVKVVESQAELYELNHTNDQATLAKLIADGN

ITNKQAESYRAYYAKNSGETRAVAD

Nucleotide

Download Length: 318 bp

                                >NTDB_id=909569 SM123_RS09970 WP_101770912.1 2059103..2059420(-) (comYC) [Streptococcus lingualis strain S5]

ATGAAAAAATTAAAAACCTATAAGGTTAAAGCCTTTACACTTATTGAAATGTTGGTGGTCTTATTGATCATCAGTGTGCT

CTTATTGCTCTTTGTGCCGAATTTGACCAAGCAAAAAGACTCCGTGAAAGAGACAGGAAATGCAGCGGTTGTGAAGGTGG

TCGAAAGCCAGGCTGAATTGTACGAGCTCAATCATACCAATGACCAAGCCACTCTAGCAAAGCTGATTGCGGATGGAAAT

ATTACCAACAAACAAGCAGAATCTTATCGTGCCTATTATGCGAAAAATAGTGGAGAAACTCGTGCGGTTGCAGATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus gordonii str. Challis substr. CH1	76.19	100	0.762
comYC	Streptococcus mutans UA159	73.333	100	0.733
comYC	Streptococcus mutans UA140	73.333	100	0.733
comGC/cglC	Streptococcus mitis SK321	67.89	100	0.705
comGC/cglC	Streptococcus mitis NCTC 12261	66.364	100	0.695
comGC/cglC	Streptococcus pneumoniae Rx1	65.138	100	0.676
comGC/cglC	Streptococcus pneumoniae R6	65.138	100	0.676
comGC/cglC	Streptococcus pneumoniae TIGR4	65.138	100	0.676
comGC/cglC	Streptococcus pneumoniae D39	65.138	100	0.676
comGC	Lactococcus lactis subsp. cremoris KW2	59.615	99.048	0.59
comYC	Streptococcus suis isolate S10	67.416	84.762	0.571
comGC	Staphylococcus aureus N315	45.918	93.333	0.429
comGC	Staphylococcus aureus MW2	45.918	93.333	0.429

Detailed information NTG0909569