Detailed information NTG0884687

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: RMQ63_RS06410
• Genome accession: NZ_CP135063
• Coordinates: 1312951..1313232 (+)
• Length: 93 a.a.
• NCBI ID: WP_074391328.1
• Uniprot ID: -
• Organism: Streptococcus suis strain ID32563
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1307951..1318232

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMQ63_RS06390 (RMQ63_06390)	-	1309612..1309986 (+)	375	WP_024385120.1	DUF1033 family protein	-
RMQ63_RS06395 (RMQ63_06395)	-	1310014..1310964 (-)	951	WP_074391326.1	S66 peptidase family protein	-
RMQ63_RS06400 (RMQ63_06400)	comYA	1311050..1312000 (+)	951	WP_074391327.1	competence type IV pilus ATPase ComGA	Machinery gene
RMQ63_RS06405 (RMQ63_06405)	comYB	1311912..1312949 (+)	1038	WP_269472402.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMQ63_RS06410 (RMQ63_06410)	comYC	1312951..1313232 (+)	282	WP_074391328.1	competence type IV pilus major pilin ComGC	Machinery gene
RMQ63_RS06415 (RMQ63_06415)	comGD	1313213..1313620 (+)	408	WP_074391329.1	competence type IV pilus minor pilin ComGD	-
RMQ63_RS06420 (RMQ63_06420)	comYE	1313592..1313885 (+)	294	WP_024401507.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMQ63_RS06425 (RMQ63_06425)	comGF/cglF	1313872..1314306 (+)	435	WP_044762030.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMQ63_RS06430 (RMQ63_06430)	comGG	1314284..1314697 (+)	414	WP_074391330.1	competence type IV pilus minor pilin ComGG	-
RMQ63_RS06435 (RMQ63_06435)	comYH	1314747..1315700 (+)	954	WP_024414316.1	class I SAM-dependent methyltransferase	Machinery gene
RMQ63_RS06440 (RMQ63_06440)	-	1315750..1316937 (+)	1188	WP_044680792.1	acetate kinase	-
RMQ63_RS06445 (RMQ63_06445)	-	1317254..1317805 (+)	552	WP_044680793.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10474.48 Da
• Isoelectric Point: 8.3596

>NTDB_id=884687 RMQ63_RS06410 WP_074391328.1 1312951..1313232(+) (comYC) [Streptococcus suis strain ID32563]
MKKLIEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSKQKDAIQKKGDAAVVKVVESQMELYELEYDKEATVEDLQKAGYI
TPKQAEQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=884687 RMQ63_RS06410 WP_074391328.1 1312951..1313232(+) (comYC) [Streptococcus suis strain ID32563]
ATGAAAAAATTAATTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGAATTATCAGCCTGCT
CTTGCTCCTCTTTGTGCCAAATTTGAGCAAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCTGCGGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTATGAATTGGAATATGATAAGGAAGCAACGGTGGAGGACTTGCAAAAGGCTGGTTATATT
ACGCCAAAACAAGCGGAGCAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	90.323	100	0.903
comGC/cglC	Streptococcus pneumoniae Rx1	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae D39	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae R6	61.957	98.925	0.613
comGC/cglC	Streptococcus pneumoniae TIGR4	61.957	98.925	0.613
comGC/cglC	Streptococcus mitis NCTC 12261	61.957	98.925	0.613
comGC/cglC	Streptococcus mitis SK321	61.957	98.925	0.613
comYC	Streptococcus gordonii str. Challis substr. CH1	62.921	95.699	0.602
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	57.955	94.624	0.548
comGC	Staphylococcus aureus MW2	48.718	83.871	0.409
comGC	Staphylococcus aureus N315	48.718	83.871	0.409
comGC	Bacillus subtilis subsp. subtilis str. 168	48	80.645	0.387