Detailed information NTG0880304

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: RJW53_RS00790
• Genome accession: NZ_CP134488
• Coordinates: 125033..125314 (+)
• Length: 93 a.a.
• NCBI ID: WP_074389246.1
• Uniprot ID: A0AAP6A9D0
• Organism: Streptococcus suis strain NLS50
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 120033..130314

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RJW53_RS00770 (RJW53_00770)	-	121696..122061 (+)	366	WP_023369079.1	DUF1033 family protein	-
RJW53_RS00775 (RJW53_00775)	-	122096..123046 (-)	951	Protein_119	S66 peptidase family protein	-
RJW53_RS00780 (RJW53_00780)	comYA	123132..124082 (+)	951	WP_044760311.1	competence type IV pilus ATPase ComGA	Machinery gene
RJW53_RS00785 (RJW53_00785)	comYB	123994..125031 (+)	1038	WP_257116212.1	competence type IV pilus assembly protein ComGB	Machinery gene
RJW53_RS00790 (RJW53_00790)	comYC	125033..125314 (+)	282	WP_074389246.1	competence type IV pilus major pilin ComGC	Machinery gene
RJW53_RS00795 (RJW53_00795)	comGD	125295..125702 (+)	408	WP_074389247.1	competence type IV pilus minor pilin ComGD	-
RJW53_RS00800 (RJW53_00800)	comYE	125674..125967 (+)	294	WP_024413203.1	competence type IV pilus minor pilin ComGE	Machinery gene
RJW53_RS00805 (RJW53_00805)	comGF/cglF	125954..126388 (+)	435	WP_074389248.1	competence type IV pilus minor pilin ComGF	Machinery gene
RJW53_RS00810 (RJW53_00810)	comGG	126366..126776 (+)	411	WP_074392769.1	competence type IV pilus minor pilin ComGG	-
RJW53_RS00815 (RJW53_00815)	-	127257..127682 (-)	426	WP_226319165.1	ArpU family phage packaging/lysis transcriptional regulator	-
RJW53_RS00820 (RJW53_00820)	-	128006..128581 (-)	576	WP_074392204.1	hypothetical protein	-
RJW53_RS00825 (RJW53_00825)	-	128602..128775 (-)	174	WP_171840772.1	hypothetical protein	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10283.21 Da
• Isoelectric Point: 7.0128

>NTDB_id=880304 RJW53_RS00790 WP_074389246.1 125033..125314(+) (comYC) [Streptococcus suis strain NLS50]
MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSKQKEAIKESGGTAVVKVVESQMELYALEHDKEATVADLQSAGYI
TEKQAEEYAKAKK

Nucleotide

• Length: 282 bp

>NTDB_id=880304 RJW53_RS00790 WP_074389246.1 125033..125314(+) (comYC) [Streptococcus suis strain NLS50]
ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGCTAGTCGTTTTGGGGATCATTAGCCTGCT
CTTGCTCCTTTTTGTGCCAAATTTGAGCAAACAAAAAGAAGCGATTAAAGAGTCCGGGGGTACAGCTGTCGTCAAAGTCG
TGGAAAGCCAGATGGAACTTTATGCATTAGAACATGATAAGGAAGCTACGGTGGCAGACTTGCAGTCGGCTGGCTATATT
ACTGAGAAACAAGCAGAAGAGTATGCTAAGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	84.946	100	0.849
comYC	Streptococcus gordonii str. Challis substr. CH1	61.798	95.699	0.591
comGC/cglC	Streptococcus mitis SK321	64.706	91.398	0.591
comGC/cglC	Streptococcus mitis NCTC 12261	64.706	91.398	0.591
comGC/cglC	Streptococcus pneumoniae D39	66.667	87.097	0.581
comGC/cglC	Streptococcus pneumoniae R6	66.667	87.097	0.581
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	87.097	0.581
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	87.097	0.581
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	55.682	94.624	0.527
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	80.645	0.376