NTDB

Overview

Name	pilA2	Type	Machinery gene
Locus tag	RCF98_RS11270	Genome accession	NZ_CP133218
Coordinates	2314408..2314833 (+)	Length	141 a.a.
NCBI ID	WP_028490495.1	Uniprot ID	-
Organism	Thiothrix lacustris strain MK1
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	2314908..2323736	2314408..2314833	flank	75

Gene organization within MGE regions

Location: 2314408..2323736

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RCF98_RS11270 (RCF98_11270)	pilA2	2314408..2314833 (+)	426	WP_028490495.1	pilin	Machinery gene
RCF98_RS11275 (RCF98_11275)	-	2314908..2315327 (+)	420	WP_028490496.1	pilin	-
RCF98_RS11280 (RCF98_11280)	-	2315400..2317343 (+)	1944	WP_308893830.1	hypothetical protein	-
RCF98_RS11285 (RCF98_11285)	-	2317360..2318307 (+)	948	WP_308396381.1	glycosyltransferase family 2 protein	-
RCF98_RS11290 (RCF98_11290)	-	2318307..2319548 (+)	1242	WP_308893832.1	glycosyltransferase	-
RCF98_RS11295 (RCF98_11295)	-	2319541..2320443 (+)	903	WP_308893833.1	glycosyltransferase family 2 protein	-
RCF98_RS11300 (RCF98_11300)	-	2320418..2321728 (+)	1311	WP_308893834.1	flippase	-
RCF98_RS11305 (RCF98_11305)	-	2321725..2322765 (+)	1041	WP_308893835.1	methyltransferase domain-containing protein	-
RCF98_RS11310 (RCF98_11310)	-	2322762..2323736 (+)	975	WP_308893837.1	glycosyltransferase family 2 protein	-

Sequence

Protein

Download Length: 141 a.a. Molecular weight: 14612.76 Da Isoelectric Point: 9.7729

                                >NTDB_id=872558 RCF98_RS11270 WP_028490495.1 2314408..2314833(+) (pilA2) [Thiothrix lacustris strain MK1]

MKAKAQKGFTLIELMIVVAIIGILAAIALPAYQDYTKRSHVSEGINLSGAAKLGVSEYYADRGTWPTTNYAVGLAGTIKG

NAVNSVGIGASGVITISYNTKAEAGKTLLLTPTDAGGSVTWDCKTGGSLNNKYRPSTCRPG

Nucleotide

Download Length: 426 bp

                                >NTDB_id=872558 RCF98_RS11270 WP_028490495.1 2314408..2314833(+) (pilA2) [Thiothrix lacustris strain MK1]

ATGAAAGCTAAAGCCCAAAAAGGTTTTACCCTGATCGAATTGATGATCGTAGTTGCCATTATCGGCATTTTGGCTGCGAT

TGCACTGCCTGCTTACCAAGATTACACCAAGCGTTCACACGTATCTGAAGGTATTAACCTTTCTGGTGCTGCGAAATTAG

GCGTTAGCGAATACTATGCTGACCGTGGTACATGGCCTACAACAAACTACGCAGTAGGTTTGGCTGGTACTATTAAAGGT

AATGCGGTGAACAGTGTTGGTATCGGTGCATCTGGTGTTATTACCATTAGCTACAATACCAAAGCAGAAGCTGGCAAAAC

ACTGTTATTAACACCAACTGATGCTGGTGGTTCTGTAACTTGGGATTGCAAAACAGGTGGTTCACTGAACAACAAATATC

GTCCATCTACTTGCCGCCCTGGTTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(38-139)

Prokaryotic N-terminal methylation motif (N_methyl)

(4-29)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA2	Legionella pneumophila strain ERS1305867	58.824	96.454	0.567
pilA2	Legionella pneumophila str. Paris	58.824	96.454	0.567
pilE	Neisseria gonorrhoeae strain FA1090	46.452	100	0.511
pilE	Neisseria gonorrhoeae MS11	46.154	100	0.511
pilA	Ralstonia pseudosolanacearum GMI1000	40.719	100	0.482
comP	Acinetobacter baylyi ADP1	46.575	100	0.482
pilA/pilA1	Eikenella corrodens VA1	41.935	100	0.461
pilA	Vibrio campbellii strain DS40M4	40.667	100	0.433
pilA/pilAI	Pseudomonas stutzeri DSM 10701	41.958	100	0.426
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	38.667	100	0.411
pilA	Vibrio cholerae strain A1552	38.667	100	0.411
pilA	Vibrio cholerae C6706	38.667	100	0.411
pilA	Haemophilus influenzae Rd KW20	43.548	87.943	0.383
pilA	Pseudomonas aeruginosa PAK	35.099	100	0.376

Detailed information NTG0872558