Detailed information NTG0082877

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: H7677_RS00735
• Genome accession: NZ_AP023391
• Coordinates: 116510..116791 (+)
• Length: 93 a.a.
• NCBI ID: WP_184493707.1
• Uniprot ID: -
• Organism: Streptococcus suis strain DAT299
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 111510..121791

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H7677_RS00715 (DAT299_01060)	-	113173..113538 (+)	366	WP_002936568.1	DUF1033 family protein	-
H7677_RS00720 (DAT299_01070)	-	113573..114523 (-)	951	WP_184493703.1	S66 peptidase family protein	-
H7677_RS00725 (DAT299_01080)	comYA	114609..115559 (+)	951	WP_184493705.1	competence type IV pilus ATPase ComGA	Machinery gene
H7677_RS00730 (DAT299_01090)	comYB	115471..116508 (+)	1038	WP_269473649.1	competence type IV pilus assembly protein ComGB	Machinery gene
H7677_RS00735 (DAT299_01100)	comYC	116510..116791 (+)	282	WP_184493707.1	competence type IV pilus major pilin ComGC	Machinery gene
H7677_RS00740 (DAT299_01110)	comGD	116772..117179 (+)	408	WP_184493709.1	competence type IV pilus minor pilin ComGD	-
H7677_RS00745 (DAT299_01120)	comYE	117151..117444 (+)	294	WP_011921722.1	competence type IV pilus minor pilin ComGE	Machinery gene
H7677_RS00750 (DAT299_01130)	comGF/cglF	117431..117865 (+)	435	WP_079268055.1	competence type IV pilus minor pilin ComGF	Machinery gene
H7677_RS00755 (DAT299_01140)	comGG	117843..118370 (+)	528	WP_184493711.1	competence type IV pilus minor pilin ComGG	-
H7677_RS00760 (DAT299_01150)	comYH	118427..119380 (+)	954	WP_184493713.1	class I SAM-dependent methyltransferase	Machinery gene
H7677_RS00765 (DAT299_01160)	-	119430..120617 (+)	1188	WP_184493715.1	acetate kinase	-
H7677_RS00770 (DAT299_01170)	-	120932..121483 (+)	552	WP_184493717.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10365.23 Da
• Isoelectric Point: 5.1548

>NTDB_id=82877 H7677_RS00735 WP_184493707.1 116510..116791(+) (comYC) [Streptococcus suis strain DAT299]
MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQEKGNAAVVKVVESQMELYELEHDEEATVADLQAKGYI
TDKQAAEYAKAKK

Nucleotide

• Length: 282 bp

>NTDB_id=82877 H7677_RS00735 WP_184493707.1 116510..116791(+) (comYC) [Streptococcus suis strain DAT299]
ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCT
CTTGCTCCTTTTTGTGCCAAATTTGAGCCAGCAAAAGGATGCCATTCAGGAGAAAGGGAATGCAGCTGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTATGAATTGGAACATGACGAGGAAGCAACGGTGGCAGATTTGCAGGCGAAAGGCTATATT
ACTGATAAACAAGCGGCAGAGTATGCTAAGGCGAAAAAGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	93.548	100	0.935
comGC/cglC	Streptococcus pneumoniae TIGR4	64.773	94.624	0.613
comGC/cglC	Streptococcus pneumoniae Rx1	64.773	94.624	0.613
comGC/cglC	Streptococcus pneumoniae D39	64.773	94.624	0.613
comGC/cglC	Streptococcus pneumoniae R6	64.773	94.624	0.613
comGC/cglC	Streptococcus mitis SK321	65.882	91.398	0.602
comGC/cglC	Streptococcus mitis NCTC 12261	65.882	91.398	0.602
comYC	Streptococcus gordonii str. Challis substr. CH1	62.921	95.699	0.602
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	55.682	94.624	0.527
comGC	Staphylococcus aureus MW2	48.718	83.871	0.409
comGC	Staphylococcus aureus N315	48.718	83.871	0.409
comGC	Bacillus subtilis subsp. subtilis str. 168	48	80.645	0.387