Detailed information NTG0081217

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: PSm6_RS15750
• Genome accession: NZ_AP023081
• Coordinates: 3460735..3461160 (-)
• Length: 141 a.a.
• NCBI ID: WP_265167711.1
• Uniprot ID: -
• Organism: Pseudomonas solani strain Sm006
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3454527..3463043	3460735..3461160	within	0

Gene organization within MGE regions

Location: 3454527..3463043

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PSm6_RS15710 (PSm6_31560)	-	3454527..3454994 (+)	468	WP_265167703.1	FAD/FMN-containing dehydrogenase	-
PSm6_RS15715 (PSm6_31570)	-	3454991..3455677 (+)	687	WP_265167704.1	energy-coupling factor ABC transporter permease	-
PSm6_RS15720 (PSm6_31580)	-	3455785..3456000 (+)	216	WP_265167705.1	hypothetical protein	-
PSm6_RS15725 (PSm6_31590)	yacG	3456004..3456204 (-)	201	WP_265167706.1	DNA gyrase inhibitor YacG	-
PSm6_RS15730 (PSm6_31600)	coaE	3456201..3456812 (-)	612	WP_265167707.1	dephospho-CoA kinase	-
PSm6_RS15735 (PSm6_31610)	pilD	3456812..3457681 (-)	870	WP_265167708.1	A24 family peptidase	Machinery gene
PSm6_RS15740 (PSm6_31620)	pilC	3457682..3458902 (-)	1221	WP_265167709.1	type II secretion system F family protein	Machinery gene
PSm6_RS15745 (PSm6_31630)	pilB	3458906..3460609 (-)	1704	WP_265167710.1	type IV-A pilus assembly ATPase PilB	Machinery gene
PSm6_RS15750 (PSm6_31640)	pilA	3460735..3461160 (-)	426	WP_265167711.1	pilin	Machinery gene
PSm6_RS15755	-	3461316..3463043 (+)	1728	WP_265167712.1	Wzy polymerase domain-containing protein	-

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 14564.58 Da
• Isoelectric Point: 8.4771

>NTDB_id=81217 PSm6_RS15750 WP_265167711.1 3460735..3461160(-) (pilA) [Pseudomonas solani strain Sm006]
MKAQKGFTLIELMIVVAIIGILAAIAIPAYQNYIGRSEAATGLAAIAPLKTAVEDYYAQGRNEGSISVTTLGSAATASPL
GEITTTNFVNGAGNLVFTFGAAGTSSGPKTSTKNITLARNTSGTWTCTTTLDPDFKPRNCQ

Nucleotide

• Length: 426 bp

>NTDB_id=81217 PSm6_RS15750 WP_265167711.1 3460735..3461160(-) (pilA) [Pseudomonas solani strain Sm006]
ATGAAAGCACAGAAAGGCTTCACCCTGATCGAACTGATGATCGTCGTCGCGATCATCGGCATCCTGGCCGCAATCGCCAT
CCCCGCGTACCAGAACTACATCGGCCGCTCCGAAGCAGCCACCGGCCTGGCAGCCATCGCTCCGTTGAAAACTGCCGTGG
AAGACTACTACGCCCAAGGTCGCAACGAAGGCTCGATCTCCGTCACCACCCTCGGCAGCGCTGCAACCGCTAGCCCGCTG
GGCGAGATTACCACTACCAACTTCGTCAACGGCGCAGGCAACCTGGTCTTCACCTTCGGCGCAGCCGGCACTTCCTCCGG
CCCCAAAACCAGCACCAAGAACATCACCCTGGCCCGCAACACCAGCGGCACCTGGACCTGCACCACTACCCTGGACCCCG
ACTTCAAGCCTCGCAACTGCCAGTGA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (36-141)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-26)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Pseudomonas aeruginosa PAK	48.667	100	0.518
pilA	Vibrio cholerae strain A1552	46.939	100	0.489
pilA	Vibrio cholerae C6706	46.939	100	0.489
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	46.939	100	0.489
pilA	Acinetobacter baumannii strain A118	44.828	100	0.461
pilA/pilAI	Pseudomonas stutzeri DSM 10701	43.624	100	0.461
comP	Acinetobacter baylyi ADP1	43.333	100	0.461
pilA	Ralstonia pseudosolanacearum GMI1000	38.365	100	0.433
pilA/pilAII	Pseudomonas stutzeri DSM 10701	44.203	97.872	0.433
pilA2	Legionella pneumophila str. Paris	42.361	100	0.433
pilA2	Legionella pneumophila strain ERS1305867	42.361	100	0.433
pilA	Vibrio parahaemolyticus RIMD 2210633	43.411	91.489	0.397