Detailed information NTG0810971

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: P7F70_RS00805
• Genome accession: NZ_CP121201
• Coordinates: 141711..142004 (+)
• Length: 97 a.a.
• NCBI ID: WP_278024842.1
• Uniprot ID: -
• Organism: Streptococcus pluranimalium strain SP28
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 136711..147004

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P7F70_RS00785 (P7F70_00785)	-	137608..138864 (-)	1257	WP_278024840.1	ISL3 family transposase	-
P7F70_RS00790 (P7F70_00790)	-	139362..139742 (+)	381	WP_218653889.1	DUF1033 family protein	-
P7F70_RS00795 (P7F70_00795)	comYA	139805..140758 (+)	954	WP_278024841.1	competence type IV pilus ATPase ComGA	Machinery gene
P7F70_RS00800 (P7F70_00800)	comYB	140691..141710 (+)	1020	WP_278025310.1	competence type IV pilus assembly protein ComGB	Machinery gene
P7F70_RS00805 (P7F70_00805)	comYC	141711..142004 (+)	294	WP_278024842.1	competence type IV pilus major pilin ComGC	Machinery gene
P7F70_RS00810 (P7F70_00810)	comGD	141985..142401 (+)	417	WP_278024843.1	competence type IV pilus minor pilin ComGD	-
P7F70_RS00815 (P7F70_00815)	comGE	142373..142672 (+)	300	WP_278024844.1	competence type IV pilus minor pilin ComGE	-
P7F70_RS00820 (P7F70_00820)	comYF	142650..143087 (+)	438	WP_278024845.1	competence type IV pilus minor pilin ComGF	Machinery gene
P7F70_RS00825 (P7F70_00825)	comGG	143065..143466 (+)	402	WP_278024846.1	competence type IV pilus minor pilin ComGG	-
P7F70_RS00830 (P7F70_00830)	comYH	143509..144462 (+)	954	WP_278024847.1	class I SAM-dependent methyltransferase	Machinery gene
P7F70_RS00835 (P7F70_00835)	-	144523..145713 (+)	1191	WP_278024848.1	acetate kinase	-
P7F70_RS00840 (P7F70_00840)	-	146077..146274 (+)	198	WP_278024849.1	helix-turn-helix transcriptional regulator	-
P7F70_RS00845 (P7F70_00845)	-	146287..146739 (+)	453	WP_115129545.1	hypothetical protein	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 11076.17 Da
• Isoelectric Point: 9.8115

>NTDB_id=810971 P7F70_RS00805 WP_278024842.1 141711..142004(+) (comYC) [Streptococcus pluranimalium strain SP28]
MTYYWKQVKRKSVKAFTLLEMLFVLLIISVLMLLFVPNLSKQKAAVDEKGKAAVVKVVESQMELYEMKEDAKPSIQQLVD
GGYITQKQADTYAEAKK

Nucleotide

• Length: 294 bp

>NTDB_id=810971 P7F70_RS00805 WP_278024842.1 141711..142004(+) (comYC) [Streptococcus pluranimalium strain SP28]
GTGACATATTATTGGAAACAAGTTAAACGAAAAAGCGTAAAAGCTTTCACACTTTTGGAAATGCTCTTCGTGCTTCTTAT
CATCAGTGTGCTTATGCTTTTGTTTGTGCCTAATTTGAGCAAGCAAAAGGCGGCTGTTGATGAAAAAGGAAAGGCAGCAG
TGGTGAAGGTTGTCGAGAGTCAGATGGAGTTGTATGAAATGAAAGAAGATGCCAAACCATCTATTCAACAATTAGTGGAT
GGTGGTTATATTACGCAAAAGCAAGCTGATACTTATGCAGAAGCTAAGAAGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	64.773	90.722	0.588
comYC	Streptococcus suis isolate S10	65.882	87.629	0.577
comGC/cglC	Streptococcus pneumoniae Rx1	63.218	89.691	0.567
comGC/cglC	Streptococcus pneumoniae D39	63.218	89.691	0.567
comGC/cglC	Streptococcus pneumoniae R6	63.218	89.691	0.567
comGC/cglC	Streptococcus mitis SK321	63.218	89.691	0.567
comGC/cglC	Streptococcus mitis NCTC 12261	63.218	89.691	0.567
comGC/cglC	Streptococcus pneumoniae TIGR4	63.218	89.691	0.567
comYC	Streptococcus mutans UA140	59.551	91.753	0.546
comYC	Streptococcus mutans UA159	59.551	91.753	0.546
comGC	Lactococcus lactis subsp. cremoris KW2	55.435	94.845	0.526
comGC	Staphylococcus aureus MW2	48.101	81.443	0.392
comGC	Staphylococcus aureus N315	48.101	81.443	0.392