NTDB

Overview

Name	comYF	Type	Machinery gene
Locus tag	P7F70_RS00820	Genome accession	NZ_CP121201
Coordinates	142650..143087 (+)	Length	145 a.a.
NCBI ID	WP_278024845.1	Uniprot ID	-
Organism	Streptococcus pluranimalium strain SP28
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 137650..148087

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P7F70_RS00790 (P7F70_00790)	-	139362..139742 (+)	381	WP_218653889.1	DUF1033 family protein	-
P7F70_RS00795 (P7F70_00795)	comYA	139805..140758 (+)	954	WP_278024841.1	competence type IV pilus ATPase ComGA	Machinery gene
P7F70_RS00800 (P7F70_00800)	comYB	140691..141710 (+)	1020	WP_278025310.1	competence type IV pilus assembly protein ComGB	Machinery gene
P7F70_RS00805 (P7F70_00805)	comYC	141711..142004 (+)	294	WP_278024842.1	competence type IV pilus major pilin ComGC	Machinery gene
P7F70_RS00810 (P7F70_00810)	comGD	141985..142401 (+)	417	WP_278024843.1	competence type IV pilus minor pilin ComGD	-
P7F70_RS00815 (P7F70_00815)	comGE	142373..142672 (+)	300	WP_278024844.1	competence type IV pilus minor pilin ComGE	-
P7F70_RS00820 (P7F70_00820)	comYF	142650..143087 (+)	438	WP_278024845.1	competence type IV pilus minor pilin ComGF	Machinery gene
P7F70_RS00825 (P7F70_00825)	comGG	143065..143466 (+)	402	WP_278024846.1	competence type IV pilus minor pilin ComGG	-
P7F70_RS00830 (P7F70_00830)	comYH	143509..144462 (+)	954	WP_278024847.1	class I SAM-dependent methyltransferase	Machinery gene
P7F70_RS00835 (P7F70_00835)	-	144523..145713 (+)	1191	WP_278024848.1	acetate kinase	-
P7F70_RS00840 (P7F70_00840)	-	146077..146274 (+)	198	WP_278024849.1	helix-turn-helix transcriptional regulator	-
P7F70_RS00845 (P7F70_00845)	-	146287..146739 (+)	453	WP_115129545.1	hypothetical protein	-
P7F70_RS00850 (P7F70_00850)	-	146773..147444 (+)	672	WP_218653900.1	type II CAAX endopeptidase family protein	-

Sequence

Protein

Download Length: 145 a.a. Molecular weight: 16896.64 Da Isoelectric Point: 9.9323

                                >NTDB_id=810972 P7F70_RS00820 WP_278024845.1 142650..143087(+) (comYF) [Streptococcus pluranimalium strain SP28]

MLKHYHLKAFTLMECLLALLVLSGSIQVYQAMTKVVSTHVRELSQPKDQDWLLFCQQFRSELIGSQLVKVSDDRLVILKN

TQTLAFGKSKKEDFRKTSGDGRGFQPMIYNIESAHFRRFNQTISVQLIFKDGRVREFLYAFEKET

Nucleotide

Download Length: 438 bp

                                >NTDB_id=810972 P7F70_RS00820 WP_278024845.1 142650..143087(+) (comYF) [Streptococcus pluranimalium strain SP28]

GTGTTAAAACATTATCACCTTAAGGCATTCACTCTGATGGAGTGTTTGCTGGCATTACTGGTCCTATCGGGCTCCATCCA

GGTTTACCAAGCTATGACTAAGGTGGTTTCAACTCATGTTCGAGAACTCAGCCAACCTAAAGATCAGGACTGGTTGCTCT

TTTGCCAGCAATTTCGCTCAGAATTAATAGGTTCTCAGTTGGTTAAAGTTTCTGATGATAGATTAGTCATCTTAAAAAAT

ACCCAAACCTTGGCTTTTGGTAAATCGAAAAAAGAGGATTTTCGTAAAACGAGCGGCGATGGTCGCGGCTTTCAACCTAT

GATTTATAACATAGAGTCAGCTCATTTTAGGCGGTTTAATCAGACCATCAGTGTTCAACTCATTTTTAAAGATGGAAGGG

TGCGTGAGTTTCTCTATGCTTTTGAAAAAGAGACTTAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(37-134)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYF	Streptococcus mutans UA159	54.483	100	0.545
comYF	Streptococcus mutans UA140	53.793	100	0.538
comGF/cglF	Streptococcus mitis NCTC 12261	43.972	97.241	0.428
comGF/cglF	Streptococcus pneumoniae Rx1	43.662	97.931	0.428
comGF/cglF	Streptococcus pneumoniae D39	43.662	97.931	0.428
comGF/cglF	Streptococcus pneumoniae R6	43.662	97.931	0.428
comGF/cglF	Streptococcus pneumoniae TIGR4	43.662	97.931	0.428
comGF/cglF	Streptococcus mitis SK321	41.135	97.241	0.4

Detailed information NTG0810972